Result : O87944
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Benzylsuccinate synthase beta subunit (EC 4.1.99.11) |
| NCBI Accession ID | AJ001848.3 |
| Organism | Thauera aromatica |
| Left | 9233 |
| Right | 9457 |
| Strand | + |
| Nucleotide Sequence | ATGAGCGCAACACCGCATACCCAGGTGCACTGGGAAGAGAACACCGCCCGCCCCTGCCGCAAGTGCAAATGGCAAACGCCCGATCCGACCGATCCGCTGCGCGGCCAATGCACCGTTAACCGCCATGCGATGGGCGGCGTGTGGAAACGCTGGATCCGCGACGTCGAGCACATGACCTGCAGCCGTCACGAGGAAGGCGAACTGAGCTTCCGCGACCACGTGTGA |
| Sequence | MSATPHTQVHWEENTARPCRKCKWQTPDPTDPLRGQCTVNRHAMGGVWKRWIRDVEHMTCSRHEEGELSFRDHV |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the addition of fumarate to the methyl group of toluene, leading to the formation of benzylsuccinate. {ECO:0000269|Pubmed:9632263}. |
| Pubmed ID | 9632263 9741082 11807562 |
| Domain | CDD:375938 |
| Functional Category | Others |
| Uniprot ID | O87944 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3303446 | 3303670 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 2 | 1481188 | 1481412 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 3 | 1107415 | 1107639 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 4 | 155907 | 156137 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 5 | 2678635 | 2678865 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 6 | 2693171 | 2693371 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 7 | 7491723 | 7491944 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 8 | 22004 | 22192 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 9 | 1742148 | 1742375 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 10 | 175468 | 175662 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 11 | 5682784 | 5682984 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 12 | 667485 | 667724 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006513.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 0.9 | 9 | 2914 | same-strand | Radical SAM superfamily |
| 2 | PF12838.9 | 0.9 | 9 | 2914 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF13237.8 | 0.9 | 9 | 2914 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13187.8 | 0.9 | 9 | 2914 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF12797.9 | 0.8 | 8 | 2910.5 | same-strand | 4Fe-4S binding domain |
| 6 | PF08201.13 | 1.0 | 10 | 2709.5 | same-strand | BssC/TutF protein |
| 7 | PF02901.17 | 1.0 | 10 | 88.5 | same-strand | Pyruvate formate lyase-like |
| 8 | PF01228.23 | 1.0 | 10 | 88.5 | same-strand | Glycine radical |
| 9 | PF07728.16 | 0.9 | 9 | 142 | same-strand | AAA domain (dynein-related subfamily) |
| 10 | PF13526.8 | 0.6 | 6 | 2745.0 | same-strand | Protein of unknown function (DUF4125) |
| 11 | PF13353.8 | 0.6 | 6 | 2918 | same-strand | 4Fe-4S single cluster domain |
| 12 | PF00037.29 | 0.6 | 6 | 2918 | same-strand | 4Fe-4S binding domain |
++ More..