Protein Information |
Information Type | Description |
---|---|
Protein name | Benzylsuccinate synthase gamma subunit (EC 4.1.99.11) [Cleaved into: Benzylsuccinate synthase gamma subunit, N-terminally processed] |
NCBI Accession ID | AJ001848.3 |
Organism | Thauera aromatica |
Left | 6350 |
Right | 6523 |
Strand | + |
Nucleotide Sequence | ATGACGACCTGCAAGGACTGTGCTTTCTTTTTTTCAATTCCAGAGGACGCGGACGATTTCGAAAAATCGAAGGGGGACTGCGTGACCCAGAAGGACGATGAAAAGGGCAGGTACTGGCTGTCCAAGCCCGTCTTCGAAAACGACCAGTGTTGCGGCGCGTTCCACAAGCGCTGA |
Sequence | MTTCKDCAFFFSIPEDADDFEKSKGDCVTQKDDEKGRYWLSKPVFENDQCCGAFHKR |
Source of smORF | Swiss-Prot |
Function | Catalyzes the addition of fumarate to the methyl group of toluene, leading to the formation of benzylsuccinate. {ECO:0000269|Pubmed:9632263}. |
Pubmed ID | 9632263 9741082 11807562 |
Domain | CDD:369746 |
Functional Category | Others |
Uniprot ID | O87942 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3300563 | 3300736 | + | NZ_CP028339.1 | Thauera aromatica K172 |
2 | 1484123 | 1484296 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
3 | 1104519 | 1104692 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
4 | 7488844 | 7489017 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
5 | 1698280 | 1698456 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
6 | 8153114 | 8153290 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
7 | 24949 | 25128 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
8 | 153029 | 153211 | + | NZ_CP059560.1 | Aromatoleum petrolei |
9 | 2681552 | 2681728 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
10 | 2696045 | 2696218 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
11 | 1745056 | 1745229 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
12 | 7153239 | 7153415 | - | NZ_CP061800.1 | Desulfonema magnum |
13 | 5685825 | 5686001 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
14 | 178376 | 178552 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
15 | 1847571 | 1847750 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
16 | 585068 | 585247 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04055.23 | 0.9 | 9 | 91 | same-strand | Radical SAM superfamily |
2 | PF12838.9 | 0.9 | 9 | 63 | same-strand | 4Fe-4S dicluster domain |
3 | PF13237.8 | 0.9 | 9 | 61.5 | same-strand | 4Fe-4S dicluster domain |
4 | PF13187.8 | 0.9 | 9 | 63 | same-strand | 4Fe-4S dicluster domain |
5 | PF12797.9 | 0.8 | 8 | 77.0 | same-strand | 4Fe-4S binding domain |
6 | PF02901.17 | 1.0 | 10 | 37.0 | same-strand | Pyruvate formate lyase-like |
7 | PF01228.23 | 1.0 | 10 | 37.0 | same-strand | Glycine radical |
8 | PF18512.3 | 0.9 | 9 | 2708.0 | same-strand | Benzylsuccinate synthase beta subunit |
9 | PF07728.16 | 0.9 | 9 | 3052.0 | same-strand | AAA domain (dynein-related subfamily) |
10 | PF13353.8 | 0.6 | 6 | 93.0 | same-strand | 4Fe-4S single cluster domain |
11 | PF00037.29 | 0.7 | 7 | 93.0 | same-strand | 4Fe-4S binding domain |