ProsmORF-pred
Result : O87387
Protein Information
Information Type Description
Protein name Sarcosine oxidase subunit delta (Sarcosine oxidase subunit D) (EC 1.5.3.1)
NCBI Accession ID AF055582.1
Organism Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Left 175
Right 453
Strand -
Nucleotide Sequence ATGGCAAGCCTCGTGCCCTGCCCGAATTGCGGGCGAAGACCCAAGGAAGAATTCACGATCAAGGGCGCGGCCCTGTCGCGACCGGAGGCCGACGCGGATTCGATCGATTGGTTCGACTACGTCTACCTGCGCGAGAACCCGCGCGGCGCCTACGAGGAATACTGGCACCACACGTCCGGGTGCCGCCGCTGGCTCGTCGTTGCCCGGGACACCGTGACGCATGAGATTGCAGCGTGCTGCGATGCGGCCGGCCGCGCTCGATCGGAGGCGCGCAAATGA
Sequence MASLVPCPNCGRRPKEEFTIKGAALSRPEADADSIDWFDYVYLRENPRGAYEEYWHHTSGCRRWLVVARDTVTHEIAACCDAAGRARSEARK
Source of smORF Swiss-Prot
Function Catalyzes the oxidative demethylation of sarcosine to yield glycine, hydrogen peroxide and 5,10-methylenetetrahydrofolate.
Pubmed ID 11481430 11474104
Domain CDD:413053
Functional Category Others
Uniprot ID O87387
ORF Length (Amino Acid) 92
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 50
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 100868 101146 - NC_020528.1 Sinorhizobium meliloti 2011
2 700682 700960 - NZ_CP034910.1 Ensifer alkalisoli
3 1942762 1943037 + NZ_CP006880.1 Rhizobium gallicum bv. gallicum R602sp
4 5057562 5057837 - NC_002678.2 Mesorhizobium japonicum MAFF 303099
5 6045616 6045891 - NC_002678.2 Mesorhizobium japonicum MAFF 303099
6 2709697 2709975 + NZ_CP010803.1 Martelella endophytica
7 567914 568192 - NZ_CP029452.1 Sinorhizobium fredii CCBAU 25509
8 214893 215156 + NZ_CP071609.1 Rhizobium binae
9 240809 241072 - NZ_CP012661.1 Defluviimonas alba
10 2005566 2005844 + NC_020062.1 Rhizobium tropici CIAT 899
11 611727 612008 + NZ_CP071680.1 Rhizobium ruizarguesonis
12 190004 190285 + NZ_CP054023.1 Rhizobium indicum
13 705038 705319 - NZ_CP035001.1 Rhizobium acidisoli
14 366327 366608 + NZ_CP013534.1 Rhizobium phaseoli
15 109042 109323 - NZ_CP071456.1 Rhizobium lentis
16 242088 242369 + NZ_CP054029.1 Rhizobium hidalgonense
17 153912 154190 - NZ_CP032695.1 Rhizobium jaguaris
18 463737 464018 + NZ_CP013503.1 Rhizobium esperanzae
19 2795909 2796184 - NC_020059.1 Rhizobium tropici CIAT 899
20 430936 431217 + NZ_CP071614.1 Rhizobium bangladeshense
21 446379 446651 + NZ_CP017942.1 Phyllobacterium zundukense
22 1114377 1114655 - NZ_CP013110.1 Sinorhizobium americanum
23 469193 469474 + NZ_CP020909.1 Rhizobium etli
24 1720970 1721248 + NZ_CP031555.1 Thalassospira indica
25 3282549 3282827 - NZ_CP032694.1 Rhizobium jaguaris
26 2145317 2145604 + NZ_CP049241.1 Rhizobium pseudoryzae
27 2807460 2807741 - NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
28 3364412 3364690 - NZ_CP041238.1 Ensifer mexicanus
29 2730640 2730918 - NZ_CP015880.1 Ensifer adhaerens
30 2517390 2517674 - NZ_CP043043.1 Gluconobacter thailandicus
31 3370559 3370786 + NZ_CP019875.1 Komagataeibacter nataicola
32 28678 28941 + NZ_CP033222.1 Parasedimentitalea marina
33 2525244 2525513 - NC_023135.1 Leisingera methylohalidivorans DSM 14336
34 1671843 1672124 + NZ_CP036404.1 Komagataeibacter saccharivorans
35 3110362 3110628 + NZ_CP020470.1 Rhodobacter blasticus
36 831720 831983 + NZ_AP014648.1 Methyloceanibacter caenitepidi
37 709044 709313 + NZ_CP041159.1 Leisingera aquaemixtae
38 1697577 1697852 - NZ_CP015064.1 Mesorhizobium ciceri biovar biserrulae
39 1636441 1636695 - NZ_CP045201.1 Pseudopuniceibacterium antarcticum
40 2410092 2410367 - NZ_CP015318.1 Mesorhizobium amorphae CCNWGS0123
41 2461208 2461480 - NZ_CP034348.1 Roseovarius faecimaris
42 6774745 6775008 - NZ_CP039690.1 Phreatobacter stygius
43 1697496 1697762 - NC_009937.1 Azorhizobium caulinodans ORS 571
44 1356852 1357088 - NZ_CP041241.1 Ensifer mexicanus
45 482326 482610 - NC_014217.1 Starkeya novella DSM 506
46 3252957 3253208 + NZ_CP006644.1 Sphingomonas sanxanigenens DSM 19645 = NX02
47 3267888 3268151 - NZ_CP048630.1 Ancylobacter pratisalsi
48 4788526 4788801 - NZ_CP050296.1 Mesorhizobium huakuii
49 5203787 5204062 + NZ_CP033361.1 Mesorhizobium erdmanii
50 5939541 5939816 + NZ_CP033507.1 Mesorhizobium jarvisii
51 1709282 1709557 - NZ_CP017147.1 Bosea vaviloviae
52 3281753 3282019 + NZ_CP025086.1 Methylovirgula ligni
53 3224896 3225165 + NZ_CP018171.1 Mesorhizobium oceanicum
54 1907312 1907584 - NZ_CP015093.1 Salipiger abyssi
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_020528.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01571.23 1.0 50 -3 same-strand Aminomethyltransferase folate-binding domain
2 PF13510.8 1.0 50 -3.0 same-strand 2Fe-2S iron-sulfur cluster binding domain
3 PF17806.3 0.98 49 -3 same-strand Sarcosine oxidase A3 domain
4 PF08669.13 0.98 49 -3.0 same-strand Glycine cleavage T-protein C-terminal barrel domain
5 PF01266.26 1.0 50 17.0 same-strand FAD dependent oxidoreductase
++ More..