| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein trl (tRNA-associated locus protein) |
| NCBI Accession ID | AF035574.1 |
| Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Left | 375 |
| Right | 635 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGGTTGTGCGTCTTCTTCGCCAACTGGTGCTCTTATCACCATGGTAACGATGCCAGTTTCTGGGAATGATGTGCAATACTCCAAAGAAGGGCGTGCGAGTTGTTGGAGTGTTTTTAGTCTTGTGGCTGCCGGTAATTGTTCGGTAGAAAAAGCGGCTAAAAGCGGCGGTGTTACCAAGATTAAAATGGTGAGCCGTGAGACAAACAACTTTTTAGGTATTGTTGGCAAATACACCACGATCGTTCAAGGCGACTAG |
| Sequence | MSGCASSSPTGTLITMVTMPVSGNDAQYSKEGRASCWSVFSLVAAGNCSVEKAAKSGGVTKIKMVSRETNNFLGIVGKYTTIVQGD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13146. Profile Description: TRL-like protein family. This family includes the TRL protein that is found in a locus that includes several tRNAs. The function of this protein is not known. The proteins in this family usually have a lipoprotein attachment site at their N-terminus. |
| Pubmed ID | 10411255 9252185 |
| Domain | CDD:404107 |
| Functional Category | Others |
| Uniprot ID | O87326 |
| ORF Length (Amino Acid) | 86 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 957470 | 957730 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 836565 | 836798 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03553.16 | 1.0 | 2 | 460.0 | same-strand | Na+/H+ antiporter family |