Protein Information |
Information Type | Description |
---|---|
Protein name | Protein trl (tRNA-associated locus protein) |
NCBI Accession ID | AF035574.1 |
Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
Left | 375 |
Right | 635 |
Strand | + |
Nucleotide Sequence | ATGAGTGGTTGTGCGTCTTCTTCGCCAACTGGTGCTCTTATCACCATGGTAACGATGCCAGTTTCTGGGAATGATGTGCAATACTCCAAAGAAGGGCGTGCGAGTTGTTGGAGTGTTTTTAGTCTTGTGGCTGCCGGTAATTGTTCGGTAGAAAAAGCGGCTAAAAGCGGCGGTGTTACCAAGATTAAAATGGTGAGCCGTGAGACAAACAACTTTTTAGGTATTGTTGGCAAATACACCACGATCGTTCAAGGCGACTAG |
Sequence | MSGCASSSPTGTLITMVTMPVSGNDAQYSKEGRASCWSVFSLVAAGNCSVEKAAKSGGVTKIKMVSRETNNFLGIVGKYTTIVQGD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam13146. Profile Description: TRL-like protein family. This family includes the TRL protein that is found in a locus that includes several tRNAs. The function of this protein is not known. The proteins in this family usually have a lipoprotein attachment site at their N-terminus. |
Pubmed ID | 10411255 9252185 |
Domain | CDD:404107 |
Functional Category | Others |
Uniprot ID | O87326 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 957470 | 957730 | + | NC_017379.1 | Helicobacter pylori Puno135 |
2 | 836565 | 836798 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03553.16 | 1.0 | 2 | 460.0 | same-strand | Na+/H+ antiporter family |