Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1564.1 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1633312 |
Right | 1633491 |
Strand | - |
Nucleotide Sequence | TTGGTGGGCTTTAGTAGTTGTAGGGTGGGCTTCAGCCCACCAACAAACAATCGTGAGATATTTTGGTGGGCTAAAGCCCACCCTACGTTAAGTACGCATCATTCTATGCGTACTTCTTTTTATTTTAGGAGCAATCATTATGATGATTTTATGCAAAAAGATTCGCGAACTTATACGTAA |
Sequence | MVGFSSCRVGFSPPTNNREIFWWAKAHPTLSTHHSMRTSFYFRSNHYDDFMQKDSRTYT |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 7542800 |
Domain | |
Functional Category | Others |
Uniprot ID | O86243 |
ORF Length (Amino Acid) | 59 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 373980 | 374135 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 431207 | 431359 | - | NZ_CP009610.1 | Haemophilus influenzae |
3 | 373767 | 373919 | - | NZ_CP009610.1 | Haemophilus influenzae |
4 | 397359 | 397511 | - | NZ_LS483429.1 | Haemophilus aegyptius |
5 | 499484 | 499636 | - | NZ_LS483429.1 | Haemophilus aegyptius |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 1.0 | 2 | 1725 | same-strand | ABC transporter |
2 | PF00664.25 | 1.0 | 2 | 962.5 | same-strand | ABC transporter transmembrane region |
3 | PF02463.21 | 1.0 | 2 | -13 | same-strand | RecF/RecN/SMC N terminal domain |
4 | PF00593.26 | 1.0 | 2 | 412.5 | opposite-strand | TonB dependent receptor |
5 | PF07715.17 | 1.0 | 2 | 316.0 | opposite-strand | TonB-dependent Receptor Plug Domain |
6 | PF04886.14 | 1.0 | 2 | 253 | opposite-strand | PT repeat |
7 | PF01381.24 | 1.0 | 2 | 3799.0 | opposite-strand | Helix-turn-helix |
8 | PF13744.8 | 1.0 | 2 | 3712 | opposite-strand | Helix-turn-helix domain |
9 | PF12848.9 | 1.0 | 2 | 4192 | opposite-strand | ABC transporter |
10 | PF16326.7 | 1.0 | 2 | 4192 | opposite-strand | ABC transporter C-terminal domain |
11 | PF02537.17 | 1.0 | 2 | 4875.0 | same-strand | CrcB-like protein, Camphor Resistance (CrcB) |
12 | PF08282.14 | 1.0 | 2 | 4057.0 | same-strand | haloacid dehalogenase-like hydrolase |
13 | PF00185.26 | 1.0 | 2 | 2650.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
14 | PF02729.23 | 1.0 | 2 | 2650.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
15 | PF00696.30 | 1.0 | 2 | 1708.0 | opposite-strand | Amino acid kinase family |
16 | PF03606.17 | 1.0 | 2 | 2324.0 | opposite-strand | C4-dicarboxylate anaerobic carrier |
17 | PF03575.19 | 1.0 | 2 | 4198.0 | opposite-strand | Peptidase family S51 |