Result : O86243
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1564.1 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1633312 |
| Right | 1633491 |
| Strand | - |
| Nucleotide Sequence | TTGGTGGGCTTTAGTAGTTGTAGGGTGGGCTTCAGCCCACCAACAAACAATCGTGAGATATTTTGGTGGGCTAAAGCCCACCCTACGTTAAGTACGCATCATTCTATGCGTACTTCTTTTTATTTTAGGAGCAATCATTATGATGATTTTATGCAAAAAGATTCGCGAACTTATACGTAA |
| Sequence | MVGFSSCRVGFSPPTNNREIFWWAKAHPTLSTHHSMRTSFYFRSNHYDDFMQKDSRTYT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O86243 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 373980 | 374135 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 431207 | 431359 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 373767 | 373919 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 4 | 397359 | 397511 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 5 | 499484 | 499636 | - | NZ_LS483429.1 | Haemophilus aegyptius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483429.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 2 | 1725 | same-strand | ABC transporter |
| 2 | PF00664.25 | 1.0 | 2 | 962.5 | same-strand | ABC transporter transmembrane region |
| 3 | PF02463.21 | 1.0 | 2 | -13 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF00593.26 | 1.0 | 2 | 412.5 | opposite-strand | TonB dependent receptor |
| 5 | PF07715.17 | 1.0 | 2 | 316.0 | opposite-strand | TonB-dependent Receptor Plug Domain |
| 6 | PF04886.14 | 1.0 | 2 | 253 | opposite-strand | PT repeat |
| 7 | PF01381.24 | 1.0 | 2 | 3799.0 | opposite-strand | Helix-turn-helix |
| 8 | PF13744.8 | 1.0 | 2 | 3712 | opposite-strand | Helix-turn-helix domain |
| 9 | PF12848.9 | 1.0 | 2 | 4192 | opposite-strand | ABC transporter |
| 10 | PF16326.7 | 1.0 | 2 | 4192 | opposite-strand | ABC transporter C-terminal domain |
| 11 | PF02537.17 | 1.0 | 2 | 4875.0 | same-strand | CrcB-like protein, Camphor Resistance (CrcB) |
| 12 | PF08282.14 | 1.0 | 2 | 4057.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 13 | PF00185.26 | 1.0 | 2 | 2650.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 14 | PF02729.23 | 1.0 | 2 | 2650.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 15 | PF00696.30 | 1.0 | 2 | 1708.0 | opposite-strand | Amino acid kinase family |
| 16 | PF03606.17 | 1.0 | 2 | 2324.0 | opposite-strand | C4-dicarboxylate anaerobic carrier |
| 17 | PF03575.19 | 1.0 | 2 | 4198.0 | opposite-strand | Peptidase family S51 |
++ More..