| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Carboxysome shell vertex protein CsoS4B |
| NCBI Accession ID | AF038430.1 |
| Organism | Halothiobacillus neapolitanus (strain ATCC 23641 / c2) (Thiobacillus neapolitanus) |
| Left | 6429 |
| Right | 6674 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGTAATGCGCGTTCGTTCCGACCTAATCGCAACACGCAGGATTCCCGGTCTTAAAAATATCTCTTTGCGTGTCATGGAGGATGCTACGGGTAAGGTCAGTGTCGCTTGCGATCCCATTGGCGTTCCCGAGGGATGTTGGGTCTTTACGATTAGCGGCTCTGCCGCTCGGTTTGGCGTGGGTGATTTTGAGATTCTCACGGATTTGACGATTGGTGGCATCATCGATCACTGGGTAACTTGA |
| Sequence | MEVMRVRSDLIATRRIPGLKNISLRVMEDATGKVSVACDPIGVPEGCWVFTISGSAARFGVGDFEILTDLTIGGIIDHWVT |
| Source of smORF | Swiss-Prot |
| Function | Probably forms vertices in the carboxysome. Has been modeled to induce curvature upon insertion into an otherwise flat hexagonal layer of major carboxysome subunits (Probable). A minor shell protein, only 12 pentamers of CsoS4A/CsoS4B are calculated to be present in each carboxysome. The 2 CsoS4 proteins contribute to the impermeability of the carboxysome to CO(2) (Pubmed:19844578). Its central pore is probably too small to allow passage of metabolites; its function might be to anchor different proteins or metabolites to the carboxysome (Probable). {ECO:0000269|Pubmed:19844578, ECO:0000305|Pubmed:18292340}.; Unlike beta-carboxysomes, alpha-carboxysomes (Cb) can form without cargo protein. CsoS2 is essential for Cb formation and is also capable of targeting foreign proteins to the Cb. The Cb shell assembles with the aid of CsoS2; CsoS1A, CsoS1B and CsoS1C form the majority of the shell while CsoS4A and CsoS4B form vertices. CsoS1D forms pseudohexamers that probably control metabolite flux into and out of the shell. {ECO:0000269|Pubmed:33116131}. |
| Pubmed ID | 9696760 18292340 19844578 22184212 33116131 31171360 |
| Domain | CDD:413110 |
| Functional Category | Others |
| Uniprot ID | O85044 |
| ORF Length (Amino Acid) | 81 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1490909 | 1491154 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 2 | 2389875 | 2390141 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 3 | 1457685 | 1457951 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 4 | 234264 | 234509 | + | NZ_CP072793.1 | Thiothrix unzii |
| 5 | 2156521 | 2156772 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 6 | 3065900 | 3066166 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 7 | 2475207 | 2475452 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 8 | 840322 | 840570 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 9 | 3164964 | 3165221 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 10 | 3297457 | 3297714 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 11 | 3075597 | 3075866 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 12 | 519495 | 519761 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 13 | 2652203 | 2652472 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 14 | 315382 | 315648 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 15 | 8454 | 8705 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 16 | 2253062 | 2253307 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 17 | 3481644 | 3481925 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 18 | 3105849 | 3106112 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 19 | 283656 | 283904 | + | NC_007959.1 | Nitrobacter hamburgensis X14 |
| 20 | 316520 | 316765 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 21 | 2499429 | 2499680 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 22 | 530609 | 530860 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 23 | 1979525 | 1979770 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 24 | 828803 | 829051 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 25 | 2067830 | 2068102 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 26 | 2167991 | 2168242 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00210.26 | 0.77 | 20 | 1087.0 | same-strand | Ferritin-like domain |
| 2 | PF00936.21 | 1.0 | 26 | 374.5 | same-strand | BMC domain |
| 3 | PF03319.15 | 0.96 | 25 | 2 | same-strand | Ethanolamine utilisation protein EutN/carboxysome |
| 4 | PF08936.12 | 0.96 | 25 | 263 | same-strand | Carboxysome Shell Carbonic Anhydrase |
| 5 | PF00101.22 | 0.96 | 25 | 4293 | same-strand | Ribulose bisphosphate carboxylase, small chain |
| 6 | PF00016.22 | 0.92 | 24 | 4717.0 | same-strand | Ribulose bisphosphate carboxylase large chain, catalytic domain |
| 7 | PF02788.18 | 0.92 | 24 | 4717.0 | same-strand | Ribulose bisphosphate carboxylase large chain, N-terminal domain |
| 8 | PF12288.10 | 0.73 | 19 | 1826 | same-strand | Carboxysome shell peptide mid-region |