Result : O84339
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein CT_335 |
| NCBI Accession ID | AE001273.1 |
| Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Left | 382668 |
| Right | 382958 |
| Strand | + |
| Nucleotide Sequence | ATGGGTAGCGGTTACGCTAAAAAGAAAAAAGAAGCCAAATTAATGGAACGCCAATTCATGGAAATGGAGGCCTCTCTTGAACAGAAACGTTTTTCTGGAGAGGCTGGAAATGGCTTGGTATCTGTAACTATCAACGGAAAATGTGACCTGGTTGATGTTCGAATTAAACCAGATTGTCTAGATCCTGAAGATCCTGAAGTAGTGGCAGACTTATTCCGCGCAGCATTTAAAGCAGCTAAAGCAGCTTTGGATAGTGAAATGTCCGCTATGCAAATGGGAATGCCGTTCTAA |
| Sequence | MGSGYAKKKKEAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCDLVDVRIKPDCLDPEDPEVVADLFRAAFKAAKAALDSEMSAMQMGMPF |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 9784136 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | O84339 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 382668 | 382958 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 736790 | 737080 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 3 | 429527 | 429817 | + | NZ_LS398098.1 | Chlamydia suis |
| 4 | 383264 | 383554 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 5 | 778997 | 779287 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 6 | 776938 | 777228 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 7 | 385132 | 385422 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 8 | 53959 | 54249 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 9 | 367314 | 367604 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000117.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 1.0 | 9 | 4 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF00004.31 | 1.0 | 9 | 4 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF13401.8 | 1.0 | 9 | 5 | same-strand | AAA domain |
| 4 | PF02896.20 | 1.0 | 9 | -3 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 5 | PF05524.15 | 1.0 | 9 | -3 | opposite-strand | PEP-utilising enzyme, N-terminal |
| 6 | PF00391.25 | 1.0 | 9 | -3 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 7 | PF00381.21 | 1.0 | 9 | 1705 | opposite-strand | PTS HPr component phosphorylation site |
| 8 | PF03772.18 | 0.89 | 8 | 2952.0 | same-strand | Competence protein |
++ More..