Result : O84034
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein CT_031 |
| NCBI Accession ID | AE001273.1 |
| Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Left | 34408 |
| Right | 34710 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAGAAAAGATCGTTTAACTAATGAAAGACTGAATAAGCTATTTGATAGCCCCTTTAGTTTGGTTAATTACGTAATTAAGCAAGCTAAGAACAAAATTGCTAGAGGAGATGTTCGTTCTTCTAATGTCGCGATTGAGGCGCTGAACTTCCTGGATCTTTATGGCATTCAGTCCGAATACGCTGAAAGAGATGATCGAGAGAGACATTTGTCTGCTACAGGAGAGAGACGAAGAGAACAAGGTTTCGGAACATCCAGAAGAAAAGATCCTTCTCTGTACAACTGGAGCGACGTGAAATAG |
| Sequence | MARKDRLTNERLNKLFDSPFSLVNYVIKQAKNKIARGDVRSSNVAIEALNFLDLYGIQSEYAERDDRERHLSATGERRREQGFGTSRRKDPSLYNWSDVK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9784136 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O84034 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 34408 | 34710 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 34936 | 35238 | + | NZ_LS398098.1 | Chlamydia suis |
| 3 | 356556 | 356858 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 4 | 743453 | 743749 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 5 | 746156 | 746452 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 6 | 149273 | 149566 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 7 | 420873 | 421169 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 8 | 26043 | 26342 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 9 | 701829 | 702122 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007899.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00886.21 | 1.0 | 9 | 2785 | same-strand | Ribosomal protein S16 |
| 2 | PF01746.23 | 1.0 | 9 | 1704 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01245.22 | 1.0 | 9 | 1314 | same-strand | Ribosomal protein L19 |
| 4 | PF01351.20 | 1.0 | 9 | 608 | same-strand | Ribonuclease HII |
| 5 | PF00625.23 | 1.0 | 9 | -3 | same-strand | Guanylate kinase |
| 6 | PF13238.8 | 0.78 | 7 | -3 | same-strand | AAA domain |
| 7 | PF09334.13 | 1.0 | 9 | 0 | same-strand | tRNA synthetases class I (M) |
| 8 | PF13604.8 | 1.0 | 9 | 1691 | opposite-strand | AAA domain |
| 9 | PF13245.8 | 1.0 | 9 | 1691 | opposite-strand | AAA domain |
| 10 | PF14490.8 | 1.0 | 9 | 1691 | opposite-strand | Helix-hairpin-helix containing domain |
| 11 | PF18335.3 | 1.0 | 9 | 1691 | opposite-strand | ATP-dependent RecD-like DNA helicase SH3 domain |
| 12 | PF13538.8 | 1.0 | 9 | 1691 | opposite-strand | UvrD-like helicase C-terminal domain |
| 13 | PF00892.22 | 0.89 | 8 | 4316.0 | opposite-strand | EamA-like transporter family |
| 14 | PF19303.1 | 0.67 | 6 | 0.0 | same-strand | Anticodon binding domain of methionyl tRNA ligase |
| 15 | PF14520.8 | 0.67 | 6 | 1666.5 | opposite-strand | Helix-hairpin-helix domain |
++ More..