Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | AM420293.1 |
Organism | Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) |
Left | 2450510 |
Right | 2450782 |
Strand | + |
Nucleotide Sequence | ATGGGTCTGCCAGGTGGATGGGAGCTCGTACTCATCGTCGGTGTCTTGGTGCTCCTCTTCGGTGCGACCAAGCTGCCGCAGATGGCGCGTTCCCTCGGCCAGTCCGCCCGCGTCTTCAAGGCCGAGGCGCGCGGCATGAAGGAAGACGAAGAGGCCGCCAAGCGCGAGAAGCAGGCCAAGTCGGAGCCGCAGCAGCTCACCGCGGGTGAGTCCAGCGCCCCGACGGTCGCGTCTCCGGTCGAGGAAACGCAGCGCAACGACAGCAAGAAGTGA |
Sequence | MGLPGGWELVLIVGVLVLLFGATKLPQMARSLGQSARVFKAEARGMKEDEEAAKREKQAKSEPQQLTAGESSAPTVASPVEETQRNDSKK |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 17369815 |
Domain | |
Functional Category | Others |
Uniprot ID | A4FBZ2 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2450510 | 2450782 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
2 | 2094672 | 2094944 | + | NZ_CP045929.1 | Saccharopolyspora coralli |
3 | 1305028 | 1305300 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
4 | 8809086 | 8809358 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
5 | 3242304 | 3242609 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
6 | 2228273 | 2228560 | - | NZ_CP023690.1 | Streptomyces spectabilis |
7 | 1126787 | 1127008 | + | NZ_CP008944.1 | Corynebacterium atypicum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13280.8 | 1.0 | 7 | 1257 | same-strand | WYL domain |
2 | PF19187.2 | 1.0 | 7 | 298 | same-strand | PafC helix-turn-helix domain |
3 | PF00902.20 | 1.0 | 7 | 20 | same-strand | Sec-independent protein translocase protein (TatC) |
4 | PF08148.14 | 1.0 | 7 | 2047 | same-strand | DSHCT (NUC185) domain |
5 | PF00270.31 | 1.0 | 7 | 2047 | same-strand | DEAD/DEAH box helicase |
6 | PF04851.17 | 1.0 | 7 | 2047 | same-strand | Type III restriction enzyme, res subunit |