Result : A4FBZ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AM420293.1 |
| Organism | Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) |
| Left | 2450510 |
| Right | 2450782 |
| Strand | + |
| Nucleotide Sequence | ATGGGTCTGCCAGGTGGATGGGAGCTCGTACTCATCGTCGGTGTCTTGGTGCTCCTCTTCGGTGCGACCAAGCTGCCGCAGATGGCGCGTTCCCTCGGCCAGTCCGCCCGCGTCTTCAAGGCCGAGGCGCGCGGCATGAAGGAAGACGAAGAGGCCGCCAAGCGCGAGAAGCAGGCCAAGTCGGAGCCGCAGCAGCTCACCGCGGGTGAGTCCAGCGCCCCGACGGTCGCGTCTCCGGTCGAGGAAACGCAGCGCAACGACAGCAAGAAGTGA |
| Sequence | MGLPGGWELVLIVGVLVLLFGATKLPQMARSLGQSARVFKAEARGMKEDEEAAKREKQAKSEPQQLTAGESSAPTVASPVEETQRNDSKK |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 17369815 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A4FBZ2 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2450510 | 2450782 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 2 | 2094672 | 2094944 | + | NZ_CP045929.1 | Saccharopolyspora coralli |
| 3 | 1305028 | 1305300 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 4 | 8809086 | 8809358 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 5 | 3242304 | 3242609 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
| 6 | 2228273 | 2228560 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 7 | 1126787 | 1127008 | + | NZ_CP008944.1 | Corynebacterium atypicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009142.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13280.8 | 1.0 | 7 | 1257 | same-strand | WYL domain |
| 2 | PF19187.2 | 1.0 | 7 | 298 | same-strand | PafC helix-turn-helix domain |
| 3 | PF00902.20 | 1.0 | 7 | 20 | same-strand | Sec-independent protein translocase protein (TatC) |
| 4 | PF08148.14 | 1.0 | 7 | 2047 | same-strand | DSHCT (NUC185) domain |
| 5 | PF00270.31 | 1.0 | 7 | 2047 | same-strand | DEAD/DEAH box helicase |
| 6 | PF04851.17 | 1.0 | 7 | 2047 | same-strand | Type III restriction enzyme, res subunit |
++ More..