ProsmORF-pred
Result : A3QDZ8
Protein Information
Information Type Description
Protein name 50S ribosomal protein L25
NCBI Accession ID CP000606.1
Organism Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Left 2105880
Right 2106167
Strand +
Nucleotide Sequence ATGTCTTACACAATTACCGCACAAACCCGCACTGAAATTGGGAAAGGTTCGAGCCGCCGCCTACGTCATGCTGGTAAAGTTCCTGCAGTTATCTATGGTGCGGGCAAAGAAGCCGTTTCTATCGAATTCGAACACCGTTCAATCATCAACATCCAAACTAACGATGATTTCTACAACAGCGACATCACTATCGTTCTAGACGGTAAAGAAGTTAAAGTTCGTGTTCAAGCTATGCAACGTCACGCGTTCAAGCCTATGATCGAGCACGTGGATTTCAAATTCGCTTAA
Sequence MSYTITAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEAVSIEFEHRSIINIQTNDDFYNSDITIVLDGKEVKVRVQAMQRHAFKPMIEHVDFKFA
Source of smORF Swiss-Prot
Function This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance. {ECO:0000255|HAMAP-Rule:MF_01336}.
Pubmed ID
Domain CDD:412568
Functional Category Ribosomal_protein
Uniprot ID A3QDZ8
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 244
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2105880 2106167 + NC_009092.1 Shewanella loihica PV-4
2 2333862 2334149 - NZ_CP022272.1 Shewanella marisflavi
3 2699223 2699510 - NZ_CP046378.1 Shewanella algae
4 1460566 1460853 + NZ_CP020373.1 Shewanella khirikhana
5 2584639 2584926 - NZ_CP022358.1 Shewanella bicestrii
6 2827100 2827387 - NC_010334.1 Shewanella halifaxensis HAW-EB4
7 2383547 2383834 + NC_009901.1 Shewanella pealeana ATCC 700345
8 2936316 2936603 - NC_011566.1 Shewanella piezotolerans WP3
9 4165996 4166283 + NZ_CP036200.1 Shewanella maritima
10 2973771 2974058 - NC_009831.1 Shewanella sediminis HAW-EB3
11 2308388 2308675 + NC_016901.1 Shewanella baltica OS678
12 1973022 1973309 + NC_008700.1 Shewanella amazonensis SB2B
13 1719245 1719532 + NC_008345.1 Shewanella frigidimarina NCIMB 400
14 2846563 2846850 - NZ_CP037952.1 Parashewanella spongiae
15 2202144 2202431 - NZ_CP037951.1 Parashewanella tropica
16 3259852 3260139 - NZ_CP034015.1 Shewanella livingstonensis
17 2843169 2843456 - NZ_CP041036.1 Shewanella polaris
18 1847037 1847324 + NZ_CP069213.1 Shewanella litorisediminis
19 660670 660957 + NZ_CP014782.1 Shewanella psychrophila
20 3164700 3164987 - NZ_CP020472.1 Shewanella japonica
21 2171728 2172015 + NC_014012.1 Shewanella violacea DSS12
22 2647302 2647589 + NC_010506.1 Shewanella woodyi ATCC 51908
23 1742231 1742518 + NC_007954.1 Shewanella denitrificans OS217
24 1399877 1400164 - NZ_CP041783.1 Shewanella donghaensis
25 2835958 2836245 - NZ_LS483250.1 Moritella yayanosii
26 3722886 3723173 - NZ_CP044399.1 Moritella marina ATCC 15381
27 1600253 1600540 + NC_014541.1 Ferrimonas balearica DSM 9799
28 801128 801415 + NZ_CP051180.1 Ferrimonas lipolytica
29 2840819 2841103 + NZ_CP015581.1 Tatumella citrea
30 1266520 1266807 + NZ_LR134167.1 Avibacterium volantium
31 1703151 1703438 + NZ_LR134510.1 Actinobacillus delphinicola
32 143806 144093 - NZ_CP021377.1 Oceanisphaera profunda
33 2993409 2993693 + NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
34 2869387 2869671 + NZ_CP012264.1 Cronobacter condimenti 1330
35 1416315 1416599 - NC_010694.1 Erwinia tasmaniensis Et1/99
36 4522218 4522502 + NZ_LT556085.1 Citrobacter amalonaticus
37 2330583 2330867 - NZ_CP045205.1 Citrobacter telavivensis
38 2373768 2374052 + NC_013961.1 Erwinia amylovora CFBP1430
39 1782491 1782775 - NZ_CP060111.1 Klebsiella michiganensis
40 2464964 2465248 + NZ_CP023567.1 Erwinia pyrifoliae
41 3177189 3177473 - NZ_CP042941.1 Atlantibacter hermannii
42 625867 626154 + NZ_CP021376.1 Oceanisphaera avium
43 212825 213112 + NZ_CP040863.1 Rodentibacter heylii
44 246877 247161 - NZ_CP038469.1 Citrobacter tructae
45 3405583 3405867 + NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
46 742417 742704 - NZ_CP015031.1 Basfia succiniciproducens
47 1101834 1102121 - NC_006300.1 [Mannheimia] succiniciproducens MBEL55E
48 1432825 1433109 - NZ_AP023184.1 Buttiauxella agrestis
49 569915 570199 - NC_009792.1 Citrobacter koseri ATCC BAA-895
50 1441090 1441377 + NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
51 531631 531915 - NZ_CP027107.1 Cronobacter sakazakii
52 1252697 1252981 - NZ_CP013940.1 Cronobacter malonaticus LMG 23826
53 2896814 2897098 + NZ_CP012257.1 Cronobacter universalis NCTC 9529
54 1057134 1057418 - NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
55 321508 321792 + NZ_CP053416.1 Salmonella bongori
56 1887584 1887868 - NC_012962.1 Photorhabdus asymbiotica
57 4642895 4643179 + NZ_CP020388.1 Pluralibacter gergoviae
58 4795628 4795912 + NZ_CP065640.1 Serratia rubidaea
59 1831489 1831773 - NZ_CP036175.1 Klebsiella huaxiensis
60 4063531 4063815 - NZ_CP044098.1 Citrobacter portucalensis
61 1005406 1005690 + NZ_CP033744.1 Citrobacter freundii
62 2436240 2436524 + NC_013716.1 Citrobacter rodentium ICC168
63 1589945 1590232 + NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
64 965122 965409 - NZ_CP006954.1 Bibersteinia trehalosi USDA-ARS-USMARC-188
65 3921400 3921684 - NZ_CP011104.1 Photorhabdus thracensis
66 3519589 3519873 + NZ_CP038662.1 Serratia nematodiphila
67 850040 850324 + NZ_CP014136.1 Gibbsiella quercinecans
68 1256867 1257151 - NZ_CP016043.1 Edwardsiella hoshinae
69 2368323 2368610 + NZ_AP022188.1 Aeromonas media
70 1264415 1264702 - NZ_LS483458.1 Haemophilus haemolyticus
71 1587261 1587545 - NZ_CP035129.1 Kosakonia cowanii
72 2326432 2326716 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
73 1288781 1289068 - NZ_LS483429.1 Haemophilus aegyptius
74 2928576 2928860 - NZ_CP023706.1 Edwardsiella tarda
75 1859373 1859660 - NZ_CP015029.1 Frederiksenia canicola
76 1753856 1754143 + NZ_CP012621.1 Zobellella denitrificans
77 1339750 1340034 - NZ_LS483470.1 Leminorella richardii
78 1305583 1305870 - NZ_CP051883.1 Aeromonas salmonicida
79 818994 819278 - NZ_CP011602.1 Phytobacter ursingii
80 2826685 2826969 + NZ_CP016948.1 Serratia surfactantfaciens
81 1378222 1378506 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
82 1127471 1127758 + NZ_CP018804.1 Histophilus somni
83 1571475 1571762 + NZ_LT906463.1 Haemophilus pittmaniae
84 1898317 1898604 - NC_012691.1 Tolumonas auensis DSM 9187
85 1384209 1384493 - NZ_LR134201.1 Cedecea lapagei
86 1580783 1581067 - NC_017554.1 Pantoea ananatis PA13
87 1421302 1421586 - NZ_CP023525.1 Cedecea neteri
88 4701630 4701914 + NZ_CP040428.1 Jejubacter calystegiae
89 308604 308888 + NZ_CP006664.1 Edwardsiella anguillarum ET080813
90 3624176 3624460 + NC_015567.1 Serratia plymuthica AS9
91 2498714 2498998 + NC_012779.2 Edwardsiella ictaluri 93-146
92 1790609 1790890 - NZ_CP072455.1 Xenorhabdus budapestensis
93 2606767 2607051 + NZ_LN907827.1 Erwinia gerundensis
94 2978086 2978370 - NZ_CP019706.1 Pantoea alhagi
95 1529008 1529295 + NZ_CP015425.1 [Haemophilus] ducreyi
96 2122633 2122917 + NZ_CP028271.1 Mixta intestinalis
97 1592515 1592799 - NZ_CP054254.1 Klebsiella variicola
98 2406082 2406369 + NZ_CP028897.1 Dongshaea marina
99 3709034 3709318 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
100 1556759 1557043 - NZ_CP071320.1 Serratia ureilytica
101 1281620 1281904 + NZ_CP049115.1 Pantoea stewartii
102 2175005 2175289 - NZ_CP051548.1 Phytobacter diazotrophicus
103 1587125 1587409 - NZ_CP046672.1 Raoultella ornithinolytica
104 1502781 1503065 - NZ_LR134475.1 Klebsiella aerogenes
105 3017582 3017866 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
106 1422257 1422544 - NZ_CP016180.1 Pasteurella skyensis
107 1542075 1542359 - NZ_CP065838.1 Klebsiella quasipneumoniae
108 1696101 1696388 + NZ_CP040449.1 Aeromonas simiae
109 1904200 1904487 - NZ_CP029206.1 Actinobacillus porcitonsillarum
110 1624108 1624395 + NZ_CP009610.1 Haemophilus influenzae
111 1670064 1670345 + NZ_CP016176.1 Xenorhabdus hominickii
112 2829180 2829464 + NZ_LR134340.1 Escherichia marmotae
113 658373 658660 - NC_011852.1 Glaesserella parasuis SH0165
114 1569674 1569958 - NZ_CP041247.1 Raoultella electrica
115 1656861 1657145 - NZ_CP011118.1 Yersinia enterocolitica
116 3569460 3569744 + NZ_LT906479.1 Serratia ficaria
117 2772599 2772883 + NZ_CP061527.1 Shigella dysenteriae
118 2305720 2306004 + NC_004337.2 Shigella flexneri 2a str. 301
119 2282517 2282801 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
120 779367 779651 - NZ_CP009056.1 Frischella perrara
121 5659867 5660151 + NZ_CP011254.1 Serratia fonticola
122 1120657 1120944 + NZ_CP016605.1 Bisgaardia hudsonensis
123 1005092 1005379 + NZ_CP016604.1 Otariodibacter oris
124 2231463 2231750 + NZ_LR134376.1 Aeromonas encheleia
125 3611812 3612096 + NZ_LR134494.1 Serratia quinivorans
126 1752630 1752914 - NZ_CP014007.2 Kosakonia oryzae
127 2710704 2710982 - NZ_CP065150.1 Vibrio kanaloae
128 2012877 2013155 + NC_011753.2 Vibrio atlanticus
129 1398838 1399125 + NZ_CP046531.1 Mannheimia ovis
130 105993 106277 + NZ_CP026047.1 Raoultella planticola
131 3530439 3530723 + NZ_CP048784.1 Serratia liquefaciens
132 575407 575694 + NZ_CP030753.1 Actinobacillus pleuropneumoniae
133 4777948 4778232 - NZ_CP045300.1 Kosakonia arachidis
134 3425247 3425531 + NZ_CP015113.1 Kosakonia radicincitans
135 1506321 1506575 - NZ_CP045845.1 Kluyvera intermedia
136 852448 852729 - NZ_CP060401.1 Xenorhabdus nematophila
137 2685984 2686265 + NZ_FO704550.1 Xenorhabdus doucetiae
138 3311680 3311934 + NZ_CP009756.1 Enterobacter cloacae
139 3112618 3112902 + NZ_CP012871.1 [Enterobacter] lignolyticus
140 1729452 1729739 - NZ_CP061280.1 Mannheimia bovis
141 3173261 3173515 + NZ_AP022508.1 Enterobacter bugandensis
142 1205499 1205786 - NZ_CP006944.1 Mannheimia varigena USDA-ARS-USMARC-1312
143 4190103 4190390 + NZ_CP043473.1 Chromobacterium paludis
144 2049715 2049993 + NZ_CP039700.1 Vibrio cyclitrophicus
145 806977 807261 - NZ_LT906448.1 Pasteurella dagmatis
146 1264085 1264366 - NZ_FO704551.1 Xenorhabdus poinarii G6
147 1692314 1692601 - NZ_CP055305.1 Mannheimia pernigra
148 2886631 2886915 - NZ_CP007044.2 Chania multitudinisentens RB-25
149 1963802 1964056 + NZ_CP023529.1 Lelliottia amnigena
150 1148866 1149150 + NZ_CP009781.1 Yersinia aldovae 670-83
151 1688255 1688539 - NZ_CP043727.1 Yersinia canariae
152 2962738 2963022 + NZ_CP046293.1 Yersinia intermedia
153 3165706 3165960 + NC_015968.1 Enterobacter soli
154 3015453 3015737 + NZ_CP026377.1 Mixta gaviniae
155 2690493 2690777 + NZ_CP034148.1 Pantoea agglomerans
156 1375209 1375493 - NZ_CP045720.1 Pantoea eucalypti
157 2853707 2853991 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
158 1268508 1268792 + NZ_CP009787.1 Yersinia rohdei
159 3002033 3002317 + NZ_LR134373.1 Yersinia pseudotuberculosis
160 3248181 3248465 - NZ_CP007230.1 Yersinia similis
161 3204742 3204996 + NZ_CP027986.1 Enterobacter sichuanensis
162 3156628 3156882 + NZ_CP017184.1 Enterobacter roggenkampii
163 4081703 4081957 - NZ_CP025034.2 Enterobacter sp. SGAir0187
164 3477476 3477730 + NZ_CP043318.1 Enterobacter chengduensis
165 521803 522087 + NZ_CP007445.1 Gilliamella apicola
166 1642236 1642520 - NZ_CP050508.1 Raoultella terrigena
167 2456034 2456288 + NZ_CP017279.1 Enterobacter ludwigii
168 1317855 1318139 - NZ_CP038853.1 Pantoea vagans
169 2363112 2363399 + NZ_CP029495.1 Chromobacterium phragmitis
170 1580364 1580648 - NZ_CP006569.1 Sodalis praecaptivus
171 2181724 2182014 + NZ_CP065534.1 Lonsdalea populi
172 4163378 4163662 + NZ_CP054043.1 Yersinia mollaretii ATCC 43969
173 311361 311615 - NZ_CP045769.1 Enterobacter cancerogenus
174 1170016 1170300 - NZ_CP032487.1 Yersinia hibernica
175 3371876 3372160 + NC_014306.1 Erwinia billingiae Eb661
176 969774 970061 - NZ_CP007715.1 Actinobacillus equuli subsp. equuli
177 924112 924399 - NZ_CP009159.1 Actinobacillus suis ATCC 33415
178 1318285 1318569 + NZ_CP034752.1 Jinshanibacter zhutongyuii
179 2847285 2847566 + NC_013892.1 Xenorhabdus bovienii SS-2004
180 2288536 2288820 + NZ_CP034035.1 Brenneria rubrifaciens
181 943079 943333 + NZ_AP019007.1 Enterobacter oligotrophicus
182 1991715 1991993 + NZ_CP031781.1 Vibrio parahaemolyticus
183 4713414 4713698 - NZ_CP016337.1 Kosakonia sacchari
184 2992022 2992306 + NZ_CP034938.1 Pectobacterium odoriferum
185 2070119 2070403 + NZ_CP028926.1 Pasteurella multocida
186 3435713 3436003 + NZ_CP023009.1 Lonsdalea britannica
187 1937103 1937387 - NZ_CP038498.1 Pectobacterium punjabense
188 736783 737067 - NZ_CP017482.1 Pectobacterium polaris
189 2089319 2089603 + NZ_CP015749.1 Pectobacterium parmentieri
190 3682964 3683248 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
191 2451934 2452221 - NZ_CP050851.1 Aeromonas hydrophila
192 2001922 2002206 - NZ_CP065044.1 Pectobacterium aroidearum
193 3249106 3249390 + NZ_CP063425.1 Kosakonia pseudosacchari
194 1982239 1982517 + NZ_CP071325.1 Photobacterium ganghwense
195 3533730 3534014 - NZ_CP047495.1 Pectobacterium brasiliense
196 2886480 2886764 + NZ_CP051652.1 Pectobacterium carotovorum
197 2877290 2877574 + NZ_CP061511.1 Mixta calida
198 2414027 2414305 + NC_013456.1 Vibrio antiquarius
199 2197857 2198141 + NZ_CP014137.1 Brenneria goodwinii
200 2888031 2888315 + NZ_CP050150.1 Hafnia alvei
201 2678861 2679142 - NZ_CP023536.1 Providencia alcalifaciens
202 1260198 1260476 - NZ_CP022355.1 Paraphotobacterium marinum
203 2497094 2497372 + NZ_CP005974.1 Photobacterium gaetbulicola Gung47
204 1601559 1601837 + NZ_CP016414.1 Vibrio scophthalmi
205 2002493 2002777 - NZ_CP009125.1 Pectobacterium atrosepticum
206 1640712 1640990 + NZ_CP009977.1 Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
207 1528348 1528632 - NZ_CP013990.1 Leclercia adecarboxylata
208 1274624 1274902 - NZ_CP030788.1 Vibrio campbellii
209 238084 238374 - NZ_CP067057.1 Rahnella aceris
210 1273255 1273533 - NZ_CP022741.1 Vibrio qinghaiensis
211 808631 808909 + NZ_CP025792.1 Vibrio jasicida 090810c
212 1256551 1256829 - NZ_CP032093.1 Vibrio alfacsensis
213 947460 947738 + NZ_LT960611.1 Vibrio tapetis subsp. tapetis
214 1849661 1849939 + NZ_CP009354.1 Vibrio tubiashii ATCC 19109
215 1455774 1456055 + NZ_CP040021.1 Salinivibrio kushneri
216 1279142 1279420 - NZ_AP019651.1 Vibrio taketomensis
217 1516399 1516677 + NZ_AP019657.1 Vibrio ponticus
218 1623803 1624081 - NZ_CP009467.1 Vibrio harveyi
219 1602087 1602365 + NZ_AP018685.1 Vibrio rumoiensis
220 438294 438572 + NZ_CP019959.1 Vibrio owensii
221 1649914 1650192 + NZ_CP047475.1 Vibrio astriarenae
222 1994715 1995002 - NZ_CP031560.1 Dickeya dianthicola
223 2000127 2000414 - NZ_LT615367.1 Dickeya aquatica
224 1958783 1959064 - NZ_CP048796.1 Providencia vermicola
225 1066835 1067113 - NZ_CP018312.1 Vibrio rotiferianus
226 1305308 1305586 - NZ_CP033078.1 Vibrio zhugei
227 558386 558646 + NZ_CP046793.1 Vibrio metschnikovii
228 3178582 3178863 + NZ_CP029736.1 Providencia rettgeri
229 1998293 1998574 + NZ_CP031123.2 Providencia huaxiensis
230 751310 751597 + NZ_CP009460.1 Dickeya fangzhongdai
231 1806825 1807103 + NZ_CP045350.1 Vibrio aquimaris
232 4211970 4212257 - NZ_CP015137.1 Dickeya solani IPO 2222
233 1143042 1143320 - NZ_AP018689.1 Vibrio aphrogenes
234 2235954 2236232 + NC_011312.1 Aliivibrio salmonicida LFI1238
235 2466545 2466832 + NZ_CP042220.2 Dickeya poaceiphila
236 1739060 1739338 - NZ_CP046268.1 Vibrio spartinae
237 2055533 2055820 - NC_014500.1 Dickeya dadantii 3937
238 1458621 1458899 - NZ_AP014635.1 Vibrio tritonius
239 2015943 2016230 - NZ_CP025799.1 Dickeya zeae
240 2796385 2796672 + NC_012912.1 Dickeya chrysanthemi Ech1591
241 1047101 1047379 - NZ_CP014035.2 Vibrio fluvialis
242 2328120 2328398 + NZ_CP040990.1 Vibrio furnissii
243 2026957 2027235 + NZ_CP070624.1 Photobacterium damselae subsp. damselae
244 1474092 1474370 - NZ_CP044069.1 Vibrio vulnificus
245 2954940 2955218 + NZ_CP014056.2 Grimontia hollisae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP015581.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00271.33 0.73 178 156.5 same-strand Helicase conserved C-terminal domain
2 PF00270.31 0.73 178 156.5 same-strand DEAD/DEAH box helicase
3 PF00849.24 0.65 159 2185.5 opposite-strand RNA pseudouridylate synthase
4 PF01479.27 0.65 158 2189 opposite-strand S4 domain
5 PF04851.17 0.66 160 156.0 same-strand Type III restriction enzyme, res subunit
++ More..