Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AE000520.1 |
Organism | Treponema pallidum (strain Nichols) |
Left | 766966 |
Right | 767169 |
Strand | - |
Nucleotide Sequence | ATGATTTTCCCAATGCAGCAGTTGATTGAGTTTCAGGGCAATATTTATGAGATTACGTGTGCAGCAACGCGTCGAGCTTTTCAACTCGCAGCGGTTTGCGACCCTGTTTTGGATGAACTTGGGGGAAAGGTGGTGTCCGCTGCAGCGCAGCAGGTGTTTTCAGGAACGGTGGACTACCGGATAGAGCCGCAGGAGTTAGGGTAG |
Sequence | MIFPMQQLIEFQGNIYEITCAATRRAFQLAAVCDPVLDELGGKVVSAAAQQVFSGTVDYRIEPQELG |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}. |
Pubmed ID | 9665876 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | O83699 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 761844 | 762047 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
2 | 1346423 | 1346629 | - | NZ_CP009228.1 | Treponema putidum |
3 | 65846 | 66052 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
4 | 1381225 | 1381416 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
5 | 1348057 | 1348248 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
6 | 1485078 | 1485275 | - | NZ_CP054142.1 | Treponema parvum |
7 | 29258 | 29464 | - | NC_022097.1 | Treponema pedis str. T A4 |
8 | 1659624 | 1659818 | + | NC_015578.1 | Treponema primitia ZAS-2 |
9 | 2350198 | 2350392 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
10 | 1677193 | 1677414 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
11 | 1829624 | 1829821 | - | NZ_CP031518.1 | Treponema ruminis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01715.19 | 0.82 | 9 | 18 | same-strand | IPP transferase |