Result : A3PS63
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c 2 (ATP synthase F(0) sector subunit c 2) (F-type ATPase subunit c 2) (F-ATPase subunit c 2) (Lipid-binding protein 2) |
| NCBI Accession ID | CP000579.1 |
| Organism | Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) |
| Left | 43791 |
| Right | 44042 |
| Strand | + |
| Nucleotide Sequence | GTGACCCCCGAAACCGTCCAGATCGCCAGCATCCTCGGCGCGGCCTTCGCCGTGGGGATAGGCTCCCTCGGCCCGGCGCTGGGGGAGGGAAGGGCCGTGGCCGCCGCCATGGAGGCCATCGCCCGCCAGCCCGAGGCCGCGGGCACCCTCTCGCGCACCCTGTTCGTGGGGCTCGCCATGATCGAGACCATGGCGATCTACTGCCTCGTGATCGCGCTCCTGCTCCTCTTCGCCAATCCCTTCACCGGCTGA |
| Sequence | MTPETVQIASILGAAFAVGIGSLGPALGEGRAVAAAMEAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVIALLLLFANPFTG |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A3PS63 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 170
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2890745 | 2890993 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 2 | 143686 | 143928 | + | NZ_AP017656.1 | Sphingobium cloacae |
| 3 | 140976 | 141218 | + | NZ_CP023451.1 | Rhizorhabdus dicambivorans |
| 4 | 314914 | 315156 | + | NZ_CP060037.1 | Sphingobium fuliginis |
| 5 | 656322 | 656564 | - | NZ_CP020539.1 | Sphingobium herbicidovorans |
| 6 | 2778716 | 2778955 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 7 | 1961107 | 1961355 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 8 | 4300331 | 4300558 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 9 | 187880 | 188128 | + | NZ_CP015093.1 | Salipiger abyssi |
| 10 | 3166970 | 3167230 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 11 | 1834964 | 1835170 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 12 | 2331003 | 2331251 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 13 | 52584 | 52814 | - | NC_007953.1 | Paraburkholderia xenovorans LB400 |
| 14 | 400554 | 400799 | - | NZ_CP015959.1 | Paraburkholderia caribensis |
| 15 | 2454512 | 2454757 | - | NZ_CP032695.1 | Rhizobium jaguaris |
| 16 | 1101073 | 1101324 | + | NZ_CP027669.1 | Simplicispira suum |
| 17 | 1113898 | 1114128 | - | NZ_CP025612.1 | Niveispirillum cyanobacteriorum |
| 18 | 1875153 | 1875425 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 19 | 2842797 | 2843045 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 20 | 1625171 | 1625452 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 21 | 566997 | 567242 | - | NZ_CP059897.1 | Ciceribacter thiooxidans |
| 22 | 334283 | 334528 | - | NZ_CP029641.1 | Paraburkholderia dokdonella |
| 23 | 3229228 | 3229464 | + | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 24 | 1176804 | 1177085 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 25 | 997000 | 997248 | - | NZ_CP014841.1 | Dyella thiooxydans |
| 26 | 2934362 | 2934592 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 27 | 987997 | 988218 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 28 | 1762392 | 1762619 | - | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 29 | 2968522 | 2968797 | + | NZ_CP072793.1 | Thiothrix unzii |
| 30 | 5958087 | 5958341 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 31 | 957935 | 958165 | + | NZ_CP009556.1 | Burkholderia oklahomensis C6786 |
| 32 | 2507470 | 2507751 | + | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 33 | 700300 | 700572 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 34 | 509485 | 509715 | + | NC_007650.1 | Burkholderia thailandensis E264 |
| 35 | 934482 | 934757 | + | NZ_CP009501.1 | Methanosarcina thermophila TM-1 |
| 36 | 155886 | 156128 | - | NZ_CP009292.1 | Novosphingobium pentaromativorans US6-1 |
| 37 | 45254 | 45484 | + | NZ_CP008782.1 | Burkholderia pseudomallei |
| 38 | 2890010 | 2890255 | + | NZ_CP019948.1 | Methylocystis bryophila |
| 39 | 128284 | 128514 | + | NZ_CP009728.1 | Burkholderia mallei |
| 40 | 796624 | 796851 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 41 | 1762592 | 1762798 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 42 | 246050 | 246259 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 43 | 2029523 | 2029738 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 44 | 6128789 | 6129022 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 45 | 2527421 | 2527648 | + | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 46 | 1431660 | 1431932 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 47 | 2724271 | 2724525 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 48 | 3025768 | 3026010 | - | NC_003552.1 | Methanosarcina acetivorans C2A |
| 49 | 1217026 | 1217307 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 50 | 4216543 | 4216800 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 51 | 2965120 | 2965356 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 52 | 2888387 | 2888629 | - | NZ_CP032683.1 | Methanosarcina flavescens |
| 53 | 977195 | 977461 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 54 | 1756251 | 1756493 | + | NZ_CP009506.1 | Methanosarcina siciliae T4/M |
| 55 | 3757107 | 3757364 | - | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 56 | 6845648 | 6845926 | - | NZ_CP043930.1 | Gimesia benthica |
| 57 | 4426940 | 4427209 | + | NZ_CP036275.1 | Maioricimonas rarisocia |
| 58 | 3662450 | 3662707 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 59 | 2401775 | 2402053 | - | NZ_CP036353.1 | Gimesia maris |
| 60 | 3189913 | 3190128 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 61 | 1895499 | 1895714 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 62 | 4585727 | 4585957 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 63 | 1965826 | 1966080 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 64 | 2318707 | 2318934 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 65 | 1599857 | 1600069 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 66 | 1129080 | 1129337 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 67 | 1107632 | 1107904 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 68 | 4021006 | 4021230 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 69 | 4252053 | 4252301 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 70 | 2939875 | 2940096 | - | NZ_CP012333.1 | Labilithrix luteola |
| 71 | 430223 | 430465 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 72 | 3819772 | 3820008 | - | NZ_CP004393.1 | Celeribacter indicus |
| 73 | 807843 | 808139 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 74 | 7312949 | 7313173 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 75 | 1702039 | 1702293 | + | NZ_CP017715.1 | Marinobacter salinus |
| 76 | 6242140 | 6242352 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 77 | 1704587 | 1704844 | + | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 78 | 1249389 | 1249601 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 79 | 2090517 | 2090750 | - | NZ_CP030032.1 | Bradymonas sediminis |
| 80 | 3087805 | 3088050 | + | NZ_LR134503.1 | Kaistella jeonii |
| 81 | 1959931 | 1960143 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 82 | 3358735 | 3358989 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 83 | 9063344 | 9063601 | - | NZ_CP036433.1 | Lignipirellula cremea |
| 84 | 41883 | 42158 | + | NZ_LN614828.1 | Legionella fallonii LLAP-10 |
| 85 | 187641 | 187907 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 86 | 2647636 | 2647911 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 87 | 2988492 | 2988770 | - | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 88 | 236825 | 237058 | - | NZ_LT906442.1 | Legionella waltersii |
| 89 | 3125929 | 3126153 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 90 | 128452 | 128721 | + | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 91 | 980772 | 981029 | - | NZ_CP041036.1 | Shewanella polaris |
| 92 | 4605600 | 4605845 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 93 | 534508 | 534732 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 94 | 908158 | 908364 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 95 | 808855 | 809124 | + | NZ_CP028136.1 | Gramella fulva |
| 96 | 1726330 | 1726575 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 97 | 4559894 | 4560139 | + | NC_015844.1 | Zobellia galactanivorans |
| 98 | 363882 | 364124 | + | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 99 | 3419976 | 3420188 | + | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 100 | 4316586 | 4316831 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 101 | 5187307 | 5187519 | - | NZ_CP053452.2 | Frigoriglobus tundricola |
| 102 | 1407375 | 1407617 | - | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 103 | 37563 | 37772 | + | NZ_CP061500.1 | Roseicitreum antarcticum |
| 104 | 2132166 | 2132444 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 105 | 2563604 | 2563846 | + | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
| 106 | 4225150 | 4225383 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 107 | 3502949 | 3503197 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 108 | 1121424 | 1121648 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 109 | 2081692 | 2081958 | - | NZ_CP017688.1 | Flavobacterium crassostreae |
| 110 | 1068220 | 1068453 | - | NZ_CP018139.1 | Halomonas aestuarii |
| 111 | 191703 | 191942 | - | NZ_CP054616.1 | Azospirillum oryzae |
| 112 | 2897717 | 2897947 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 113 | 1820167 | 1820391 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 114 | 2275878 | 2276096 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 115 | 1149462 | 1149698 | + | NZ_CP039965.1 | Pseudorhodobacter turbinis |
| 116 | 2577837 | 2578079 | - | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
| 117 | 220063 | 220350 | - | NZ_CP011494.1 | Marinobacter psychrophilus |
| 118 | 1921973 | 1922200 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 119 | 2456615 | 2456839 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 120 | 2456199 | 2456456 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 121 | 5344194 | 5344439 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 122 | 1998534 | 1998797 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 123 | 2269129 | 2269374 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 124 | 317799 | 318041 | + | NZ_CP014169.1 | Sphingomonas panacis |
| 125 | 2128861 | 2129085 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 126 | 1833781 | 1833999 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 127 | 437034 | 437273 | - | NZ_CP029831.1 | Azospirillum ramasamyi |
| 128 | 2466048 | 2466260 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 129 | 591374 | 591586 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 130 | 3316040 | 3316285 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 131 | 2131485 | 2131730 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 132 | 603571 | 603810 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 133 | 3006034 | 3006249 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 134 | 3477700 | 3477945 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 135 | 2012914 | 2013147 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 136 | 1270203 | 1270448 | - | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 137 | 880061 | 880264 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 138 | 3702179 | 3702424 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 139 | 894430 | 894642 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 140 | 1607895 | 1608128 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 141 | 637122 | 637355 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 142 | 3784747 | 3784950 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 143 | 1524441 | 1524665 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 144 | 498366 | 498611 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 145 | 1463765 | 1464013 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 146 | 33321 | 33578 | - | NC_022358.1 | Sulfuricella denitrificans skB26 |
| 147 | 303760 | 303963 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 148 | 1695590 | 1695856 | - | NZ_CP009978.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 149 | 915964 | 916167 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 150 | 800030 | 800242 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 151 | 236369 | 236614 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 152 | 429187 | 429435 | - | NZ_CP061799.1 | Desulfonema limicola |
| 153 | 1648055 | 1648321 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 154 | 5405384 | 5405590 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 155 | 142795 | 143034 | - | NZ_CP029354.1 | Azospirillum thermophilum |
| 156 | 1180404 | 1180610 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 157 | 1505784 | 1505990 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 158 | 2865254 | 2865505 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 159 | 1351950 | 1352174 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 160 | 2839346 | 2839573 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 161 | 231997 | 232203 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 162 | 2767488 | 2767691 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 163 | 99226 | 99432 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 164 | 495910 | 496116 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 165 | 6447968 | 6448216 | + | NZ_CP061800.1 | Desulfonema magnum |
| 166 | 537722 | 537943 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 167 | 12493 | 12717 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 168 | 2934520 | 2934726 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 169 | 2254520 | 2254723 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 170 | 766262 | 766486 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 171 | 1144083 | 1144343 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 172 | 282712 | 282972 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 173 | 1220744 | 1221004 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 174 | 1263322 | 1263540 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 175 | 1157267 | 1157527 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 176 | 1450823 | 1451083 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 177 | 614997 | 615200 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 178 | 481167 | 481370 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 179 | 21984 | 22187 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 180 | 5150613 | 5150837 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 181 | 3379171 | 3379392 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 182 | 2366804 | 2367025 | + | NZ_LS974202.1 | Mesotoga infera |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022196.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.87 | 148 | 1356 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 0.88 | 150 | 1628 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF02823.18 | 0.71 | 121 | 1356.5 | same-strand | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
| 4 | PF09527.12 | 0.86 | 146 | 1041.0 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 5 | PF12966.9 | 0.69 | 117 | 733 | same-strand | N-ATPase, AtpR subunit |
| 6 | PF00119.22 | 0.94 | 159 | 51 | same-strand | ATP synthase A chain |
| 7 | PF00430.20 | 0.89 | 151 | 10.5 | same-strand | ATP synthase B/B' CF(0) |
| 8 | PF00306.29 | 0.75 | 128 | 798 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 9 | PF00231.21 | 0.85 | 145 | 2332.0 | same-strand | ATP synthase |
++ More..