Result : O83598
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphocarrier protein HPr (Histidine-containing protein) |
| NCBI Accession ID | AE000520.1 |
| Organism | Treponema pallidum (strain Nichols) |
| Left | 640705 |
| Right | 640971 |
| Strand | - |
| Nucleotide Sequence | ATGGTCGTAAAAACGGTGCGCGTGCTTAATCGTGCGGGCGTACATGCGCGTCCTGCGGCGCTTATTGTGCAAGCGGCAAGTCGCTTTGATTCGAAGATAATGCTTGTGCGGGATACGATCAGAGTGAATGCAAAGTCTATTATGGGTGTTATGGCTATGGCTGCAGGGTGTGGAAGTGAGCTCGAGTTGGTTGTAGAAGGTCCAGACGAAGTTGCTGCATTGTCCGCCATTGAGCGGCTATTTCAGAATAAATTCGAGGAAGAGTAA |
| Sequence | MVVKTVRVLNRAGVHARPAALIVQAASRFDSKIMLVRDTIRVNAKSIMGVMAMAAGCGSELELVVEGPDEVAALSAIERLFQNKFEEE |
| Source of smORF | Swiss-Prot |
| Function | General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain. {ECO:0000250}. |
| Pubmed ID | 9665876 |
| Domain | CDD:412221 |
| Functional Category | Others |
| Uniprot ID | O83598 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 638182 | 638448 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 2 | 2280208 | 2280474 | + | NZ_CP009228.1 | Treponema putidum |
| 3 | 443953 | 444219 | + | NZ_CP054142.1 | Treponema parvum |
| 4 | 435891 | 436157 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 5 | 2518167 | 2518433 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 6 | 3260269 | 3260535 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 7 | 1476789 | 1477055 | + | NZ_CP009687.1 | Clostridium aceticum |
| 8 | 2427155 | 2427421 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 9 | 4380049 | 4380315 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 10 | 1332145 | 1332411 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 11 | 3560668 | 3560934 | - | NC_023035.1 | Salinispira pacifica |
| 12 | 3628991 | 3629257 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 13 | 3056910 | 3057176 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 14 | 1552554 | 1552820 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 15 | 2919710 | 2919976 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 16 | 3796789 | 3797058 | + | NZ_CP053073.1 | Usitatibacter palustris |
| 17 | 4367495 | 4367764 | + | NZ_CP053069.1 | Usitatibacter rugosus |
| 18 | 4466306 | 4466572 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 19 | 2726745 | 2727002 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 20 | 1788466 | 1788732 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 21 | 2151961 | 2152230 | + | NZ_CP016171.1 | Bordetella bronchialis |
| 22 | 567616 | 567873 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 23 | 1785646 | 1785903 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 24 | 3808909 | 3809178 | - | NZ_CP016172.1 | Bordetella flabilis |
| 25 | 3636437 | 3636703 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 26 | 1414099 | 1414368 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 27 | 1259814 | 1260083 | - | NC_018518.1 | Bordetella pertussis 18323 |
| 28 | 1958749 | 1959018 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 29 | 3287852 | 3288121 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 30 | 3548724 | 3548993 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 31 | 1028786 | 1029052 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 32 | 3359135 | 3359392 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 33 | 662698 | 662955 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 34 | 3751872 | 3752099 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 35 | 2115180 | 2115410 | - | NZ_CP043146.1 | Bordetella holmesii |
| 36 | 3971952 | 3972209 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 37 | 4243253 | 4243522 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 38 | 3030729 | 3030998 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 39 | 2203259 | 2203528 | - | NC_017964.1 | Advenella kashmirensis WT001 |
| 40 | 2497156 | 2497425 | - | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 41 | 3668260 | 3668514 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 42 | 538577 | 538846 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 43 | 4048995 | 4049261 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 44 | 1129340 | 1129606 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 45 | 2268600 | 2268857 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 46 | 211329 | 211586 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 47 | 3084351 | 3084608 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 48 | 1955432 | 1955689 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 49 | 905695 | 905964 | - | NZ_AP018560.1 | Aerosticca soli |
| 50 | 1032018 | 1032287 | - | NZ_CP029843.1 | Lysobacter maris |
| 51 | 764203 | 764460 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 52 | 2263959 | 2264177 | + | NZ_CP021434.1 | Tumebacillus avium |
| 53 | 3871051 | 3871266 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
++ More..