Protein name |
50S ribosomal protein L29 |
NCBI Accession ID |
CP000576.1 |
Organism |
Prochlorococcus marinus (strain MIT 9301) |
Left |
1467566 |
Right |
1467784 |
Strand |
- |
Nucleotide Sequence |
ATGAAAAACTCAGAGTCTCTTAAAGAATTTAAAAAATTAAATTCCGATCAAATTACTGAAAAGATTGGCCAATTAAGAAAAGATCTTTTTGAATTGAGATTCAAGCAAGCTACGAGACAGCTTAATGAAACTCATAAATTTAAAATCATCAAGAAACAAGTTGCGCAATTACTAACTCTTAGTAAGACTCAATCTGCTTCTAAAACTACTTCTGATTAA |
Sequence |
MKNSESLKEFKKLNSDQITEKIGQLRKDLFELRFKQATRQLNETHKFKIIKKQVAQLLTLSKTQSASKTTSD |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
Pubmed ID |
18159947
|
Domain |
CDD:415815 |
Functional Category |
Ribosomal_protein |
Uniprot ID |
A3PF39
|
ORF Length (Amino Acid) |
72 |