Result : O83371
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein TP_0352 |
| NCBI Accession ID | AE000520.1 |
| Organism | Treponema pallidum (strain Nichols) |
| Left | 376944 |
| Right | 377201 |
| Strand | + |
| Nucleotide Sequence | ATGCGAGAAAAGGAAGGAGGTGTGGTGAACGACGATTTTCACTATGAAGTGACGCGCAACTGGGGCACGCTTTCCACATCGGGGAATGGCTGGTCCCTCGAACTGAAGTCTATTTCTTGGAATGGCCGGCCAGAGAAATATGATATCCGCGCGTGGTCCCCAGACAAGAGCAAGATGGGAAAGGGGGTAACGCTTACGCGTGCAGAGATTGTAGCCCTGCGCGATTTACTAAACAGTATGTCCCTGGACCCGTACTAG |
| Sequence | MREKEGGVVNDDFHYEVTRNWGTLSTSGNGWSLELKSISWNGRPEKYDIRAWSPDKSKMGKGVTLTRAEIVALRDLLNSMSLDPY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21701. Profile Description: Transcriptional Coactivator p15 (PC4). p15 has a bipartite structure composed of an amino-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain. The DNA-binding activity of the carboxy-terminal is disguised by the amino-terminal p15 domain. Activity is controlled by protein kinases that target the regulatory domain. |
| Pubmed ID | 9665876 |
| Domain | CDD:419792 |
| Functional Category | Others |
| Uniprot ID | O83371 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 373749 | 374006 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 2 | 1780115 | 1780336 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 3 | 1174332 | 1174562 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 4 | 2598012 | 2598242 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 5 | 2516284 | 2516508 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 6 | 765040 | 765267 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 7 | 1452340 | 1452561 | + | NZ_CP009687.1 | Clostridium aceticum |
| 8 | 108411 | 108638 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 9 | 139102 | 139323 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 10 | 2455458 | 2455673 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 11 | 940012 | 940233 | + | NZ_CP009288.1 | Paenibacillus durus |
| 12 | 1725108 | 1725323 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 13 | 810748 | 810972 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 14 | 660387 | 660605 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 15 | 1530750 | 1530971 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 16 | 973557 | 973778 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 17 | 571358 | 571579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 18 | 3138448 | 3138669 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 19 | 1071233 | 1071469 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 20 | 1238537 | 1238749 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 21 | 4791384 | 4791605 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 22 | 4194926 | 4195147 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 23 | 5483712 | 5483933 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 24 | 1167410 | 1167622 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 25 | 1943081 | 1943314 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 26 | 2621706 | 2621927 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 27 | 642358 | 642579 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 28 | 1044103 | 1044324 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 29 | 5137227 | 5137448 | - | NZ_CP020953.1 | Clostridium drakei |
| 30 | 5140175 | 5140396 | - | NZ_CP020953.1 | Clostridium drakei |
| 31 | 3031175 | 3031411 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 32 | 702076 | 702282 | + | NZ_LR134483.1 | Listeria grayi |
| 33 | 510517 | 510738 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 34 | 596447 | 596653 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 35 | 1453450 | 1453662 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 36 | 1252450 | 1252662 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 37 | 2906721 | 2906945 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 38 | 658952 | 659176 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 39 | 1269636 | 1269860 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 40 | 212535 | 212759 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 41 | 86094 | 86306 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
++ More..