Result : A3PAX5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein I (PSII-I) (PSII 4.4 kDa protein) |
| NCBI Accession ID | CP000576.1 |
| Organism | Prochlorococcus marinus (strain MIT 9301) |
| Left | 253494 |
| Right | 253622 |
| Strand | + |
| Nucleotide Sequence | ATGCTTGCCTTAAAAATTTCTGTTTACACTATCGTCTTCTTCTTCGTTGGAATATTTCTTTTCGGCTTTTTGGCAAGTGATCCAACAAGGACGCCTAATAGAAAGGATCTAGAGAGTCCTCAAGATTAA |
| Sequence | MLALKISVYTIVFFFVGIFLFGFLASDPTRTPNRKDLESPQD |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII), required for its stability and/or assembly. PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_01316}. |
| Pubmed ID | 18159947 |
| Domain | CDD:332231 |
| Functional Category | Others |
| Uniprot ID | A3PAX5 |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3305407 | 3305523 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 2 | 3426180 | 3426296 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 3 | 5033586 | 5033702 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 4 | 3730253 | 3730369 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 5 | 5592911 | 5593027 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 6 | 475941 | 476060 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 7 | 822506 | 822622 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 8 | 6337760 | 6337876 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 9 | 3498154 | 3498270 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 8234018 | 8234134 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 11 | 2592913 | 2593029 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 12 | 1753362 | 1753478 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 13 | 4706683 | 4706799 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 14 | 275624 | 275752 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 15 | 3570910 | 3571026 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 16 | 1711524 | 1711640 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 17 | 34217 | 34333 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 18 | 3603883 | 3603999 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 19 | 750844 | 750960 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 20 | 1055420 | 1055536 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 21 | 1994889 | 1995008 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 22 | 3831880 | 3831996 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 23 | 5173407 | 5173523 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 24 | 7078433 | 7078549 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 25 | 1645108 | 1645224 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 1787130 | 1787246 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 27 | 1250774 | 1250890 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 28 | 3273373 | 3273489 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 29 | 674349 | 674465 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 30 | 1109716 | 1109832 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014638.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12600.10 | 0.83 | 25 | 197 | same-strand | Protein of unknown function (DUF3769) |
++ More..