Result : O69622
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Apoptosis inhibitor Rv3654c |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 4094660 |
| Right | 4094914 |
| Strand | - |
| Nucleotide Sequence | GTGGTGGCTCGTCACCGCGCACAGGCGGCGGCTGATCTGGCTTCGTTAGCCGCTGCCGCCCGGCTGCCGTCCGGACTGGCGGCGGCCTGCGCGCGTGCGACGCTGGTGGCCCGTGCGATGCGCGTCGAGCACGCGCAGTGCAGGGTGGTGGACCTCGACGTGGTCGTCACCGTCGAGGTGGCTGTCGCGTTCGCGGGTGTGGCGACCGCCACCGCGCGGGCGGGGCCGGCCAAGGTGCCCACGACACCGGGTTGA |
| Sequence | MVARHRAQAAADLASLAAAARLPSGLAAACARATLVARAMRVEHAQCRVVDLDVVVTVEVAVAFAGVATATARAGPAKVPTTPG |
| Source of smORF | Swiss-Prot |
| Function | Effector protein that participates in the suppression of macrophage apoptosis by blocking the extrinsic pathway. Recognizes the host polypyrimidine tract binding protein-associated splicing factor (PSF), which probably leads to its cleavage, diminishing the level of caspase-8 in macrophages. {ECO:0000269|Pubmed:20454556}. |
| Pubmed ID | 9634230 20454556 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O69622 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4094660 | 4094914 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 4164551 | 4164805 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 5397998 | 5398237 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 4 | 636732 | 636980 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 5 | 6236406 | 6236654 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 6 | 406881 | 407120 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 7 | 4131731 | 4131991 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 8 | 5621673 | 5621930 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 9 | 376135 | 376389 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 10 | 4186239 | 4186466 | - | NC_015576.1 | Mycolicibacter sinensis |
| 11 | 2441745 | 2441972 | + | NZ_AP022562.1 | Mycobacterium novum |
| 12 | 1106224 | 1106430 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 13 | 4263496 | 4263726 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 14 | 4026990 | 4027280 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 15 | 2062758 | 2063015 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 16 | 1496848 | 1497102 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 17 | 4965570 | 4965824 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 18 | 2832402 | 2832656 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 19 | 5786147 | 5786404 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 20 | 5523053 | 5523310 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 21 | 695546 | 695800 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 22 | 409840 | 410085 | + | NZ_AP023396.1 | Nocardia wallacei |
| 23 | 4434975 | 4435217 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 24 | 3817559 | 3817813 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 25 | 6103197 | 6103448 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 26 | 1287121 | 1287378 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 27 | 4162543 | 4162785 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 28 | 6140709 | 6140972 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 29 | 1059780 | 1060049 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 30 | 4447181 | 4447435 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 31 | 4895200 | 4895451 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 32 | 351425 | 351694 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 33 | 1040760 | 1041029 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 34 | 3584320 | 3584538 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 35 | 630094 | 630348 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 36 | 1110300 | 1110548 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 37 | 804587 | 804853 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 38 | 601351 | 601593 | + | NZ_CP015961.1 | Dietzia timorensis |
| 39 | 3338219 | 3338497 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 40 | 1147407 | 1147664 | + | NZ_LR134352.1 | Nocardia asteroides |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012150.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00313.24 | 0.88 | 35 | 3977 | same-strand | 'Cold-shock' DNA-binding domain |
| 2 | PF00270.31 | 0.97 | 39 | 1329 | opposite-strand | DEAD/DEAH box helicase |
| 3 | PF09369.12 | 0.97 | 39 | 1329 | opposite-strand | Domain of unknown function (DUF1998) |
| 4 | PF00271.33 | 0.95 | 38 | 1329.0 | opposite-strand | Helicase conserved C-terminal domain |
| 5 | PF18621.3 | 0.75 | 30 | 9.0 | opposite-strand | Family of unknown function (DUF5628) |
| 6 | PF18007.3 | 0.75 | 30 | 9.0 | opposite-strand | Domain of unknown function (DUF5593) |
| 7 | PF14029.8 | 0.95 | 38 | 415.0 | same-strand | Protein of unknown function (DUF4244) |
| 8 | PF00482.25 | 0.97 | 39 | 911 | same-strand | Type II secretion system (T2SS), protein F |
| 9 | PF00437.22 | 0.8 | 32 | 2021.5 | same-strand | Type II/IV secretion system protein |
| 10 | PF01131.22 | 0.65 | 26 | 5024.0 | same-strand | DNA topoisomerase |
| 11 | PF13368.8 | 0.65 | 26 | 5024.0 | same-strand | Topoisomerase C-terminal repeat |
| 12 | PF01751.24 | 0.6 | 24 | 5020.0 | same-strand | Toprim domain |
++ More..