Result : O68986
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chlorosome envelope protein F |
| NCBI Accession ID | AF060078.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 1315 |
| Right | 1548 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAACGAATCAGGAAACATCGGCGTATTTGGCGATCTCTTCACCGCTGTGGGCGATTTGGCCCAGCAGGCTGTGGACATGGCTGGCAGCGCGCTCAAAACCGCTACCGACACCGTTCAGCCGGTTACCAATGCATGCGTGCAACTCTGCACCACCAGCATCAATTCGGCAACGCAGCTTGTCGAGGGTGCCACCAAAGCCATCACCACGGCGATCGCACCGAAGCAGTAA |
| Sequence | MANESGNIGVFGDLFTAVGDLAQQAVDMAGSALKTATDTVQPVTNACVQLCTTSINSATQLVEGATKAITTAIAPKQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11914082 12093901 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O68986 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 983645 | 983878 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 1336298 | 1336531 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 3 | 1079641 | 1079871 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13649.8 | 1.0 | 3 | 4441 | same-strand | Methyltransferase domain |
| 2 | PF08241.14 | 1.0 | 3 | 4441 | same-strand | Methyltransferase domain |
| 3 | PF08242.14 | 1.0 | 3 | 4441 | same-strand | Methyltransferase domain |
| 4 | PF01979.22 | 1.0 | 3 | 2766 | same-strand | Amidohydrolase family |
| 5 | PF12890.9 | 1.0 | 3 | 2766 | same-strand | Dihydro-orotase-like |
| 6 | PF01557.20 | 1.0 | 3 | 2036 | same-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 7 | PF00805.24 | 0.67 | 2 | 130.0 | opposite-strand | Pentapeptide repeats (8 copies) |
| 8 | PF13599.8 | 0.67 | 2 | 130.0 | opposite-strand | Pentapeptide repeats (9 copies) |
| 9 | PF13576.8 | 0.67 | 2 | 130.0 | opposite-strand | Pentapeptide repeats (9 copies) |
| 10 | PF01812.22 | 1.0 | 3 | 326 | opposite-strand | 5-formyltetrahydrofolate cyclo-ligase family |
| 11 | PF17941.3 | 1.0 | 3 | 922 | opposite-strand | Polyphosphate kinase C-terminal domain 1 |
| 12 | PF02503.19 | 1.0 | 3 | 922 | opposite-strand | Polyphosphate kinase middle domain |
| 13 | PF13090.8 | 1.0 | 3 | 922 | opposite-strand | Polyphosphate kinase C-terminal domain 2 |
| 14 | PF13089.8 | 1.0 | 3 | 922 | opposite-strand | Polyphosphate kinase N-terminal domain |
| 15 | PF02502.20 | 1.0 | 3 | 3063 | opposite-strand | Ribose/Galactose Isomerase |
| 16 | PF01546.30 | 1.0 | 3 | 4222 | opposite-strand | Peptidase family M20/M25/M40 |
| 17 | PF07687.16 | 1.0 | 3 | 4222 | opposite-strand | Peptidase dimerisation domain |
++ More..