| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Gas vesicle protein GvpS |
| NCBI Accession ID | AF053765.1 |
| Organism | Bacillus megaterium |
| Left | 2098 |
| Right | 2385 |
| Strand | - |
| Nucleotide Sequence | ATGTCTCTTAAACAATCCATGGAGAATAAAGATATTGCTCTTATTGATATTTTAGATGTCATTTTAGATAAAGGAGTCGCCATTAAAGGAGACTTAATCATTTCCATAGCTGGCGTCGATTTAGTGTATTTGGATTTGCGGGTGCTTATTTCTTCGGTTGAAACGCTTGTGCAAGCAAAAGAAGGAAATCACAAACCAATCACTTCTGAACAATTTGATAAACAAAAGGAGGAATTAATGGATGCAACCGGTCAGCCAAGCAAATGGACGAATCCACTTGGATCCTGA |
| Sequence | MSLKQSMENKDIALIDILDVILDKGVAIKGDLIISIAGVDLVYLDLRVLISSVETLVQAKEGNHKPITSEQFDKQKEELMDATGQPSKWTNPLGS |
| Source of smORF | Swiss-Prot |
| Function | Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism at the favorable depth for growth (By similarity). {ECO:0000250}. |
| Pubmed ID | 9573198 |
| Domain | CDD:413533 |
| Functional Category | Others |
| Uniprot ID | O68671 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3183302 | 3183589 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 2 | 1348279 | 1348557 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 3 | 3800276 | 3800545 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 4 | 1583172 | 1583435 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 5 | 3045390 | 3045662 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 6 | 3110868 | 3111161 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 7 | 2269 | 2520 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 8 | 17845 | 18096 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 9 | 3092490 | 3092750 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 10 | 361731 | 361979 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 11 | 661633 | 661893 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 12 | 614575 | 614823 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00741.20 | 1.0 | 12 | 307.0 | same-strand | Gas vesicle protein |
| 2 | PF05121.14 | 1.0 | 12 | -34.0 | same-strand | Gas vesicle protein K |
| 3 | PF06386.13 | 1.0 | 12 | 742.0 | same-strand | Gas vesicle synthesis protein GvpL/GvpF |
| 4 | PF05120.14 | 1.0 | 12 | 834.5 | same-strand | Gas vesicle protein G |
| 5 | PF07728.16 | 0.67 | 8 | 1871.5 | same-strand | AAA domain (dynein-related subfamily) |