Result : O68669
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Gas vesicle protein GvpJ |
| NCBI Accession ID | AF053765.1 |
| Organism | Bacillus megaterium |
| Left | 1536 |
| Right | 1838 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGTCGAACATAATATGCAGTCAAGTACGATTGTAGATGTGCTCGAAAAGATTTTGGATAAAGGAGTCGTTATAGCGGGGGACATCACCGTAGGAATTGCAGATGTCGAGCTATTAACGATTAAGATCCGCTTGATTGTGGCTTCGGTTGATAAGGCAAAAGAAATCGGCATGGACTGGTGGGAAAATGATCCGTATCTCAGTTCAAAAGGAGCCAATAACAAAGCGCTCGAAGAAGAAAATAAAATGCTGCATGAGCGGTTAAAAACGCTTGAAGAAAAAATAGAAACGAAACGTTAA |
| Sequence | MAVEHNMQSSTIVDVLEKILDKGVVIAGDITVGIADVELLTIKIRLIVASVDKAKEIGMDWWENDPYLSSKGANNKALEEENKMLHERLKTLEEKIETKR |
| Source of smORF | Swiss-Prot |
| Function | Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism at the favorable depth for growth. This protein could be important for the shape determination of the gas vesicle. |
| Pubmed ID | 9573198 |
| Domain | CDD:413533 |
| Functional Category | Others |
| Uniprot ID | O68669 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3182740 | 3183042 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 2 | 3044819 | 3045124 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 3 | 1348872 | 1349207 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 4 | 3799668 | 3800000 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 5 | 1297791 | 1298102 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 6 | 1583729 | 1584088 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 7 | 3111416 | 3111724 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 8 | 3091877 | 3092191 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 9 | 660977 | 661315 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 10 | 615156 | 615479 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 11 | 360842 | 361159 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 12 | 8297456 | 8297710 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 13 | 8606219 | 8606470 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 14 | 8007848 | 8008183 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 15 | 6366638 | 6366883 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 16 | 6867160 | 6867498 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 17 | 2623225 | 2623521 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 18 | 7231742 | 7232002 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 19 | 7692348 | 7692611 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 20 | 6186601 | 6186855 | + | NZ_CP029043.1 | Streptomyces nigra |
| 21 | 6697259 | 6697516 | - | NZ_CP029043.1 | Streptomyces nigra |
| 22 | 6789250 | 6789501 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 23 | 610856 | 611209 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 24 | 6676468 | 6676782 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 25 | 2862748 | 2863008 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 26 | 2308847 | 2309098 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 27 | 6674368 | 6674619 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 28 | 1193653 | 1193979 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 29 | 1947508 | 1947750 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 30 | 2530020 | 2530271 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 31 | 5991449 | 5991700 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 32 | 6072293 | 6072535 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 33 | 1542637 | 1542984 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 34 | 7401439 | 7401702 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 35 | 9457299 | 9457541 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 36 | 6925955 | 6926197 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 37 | 6690795 | 6691046 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 38 | 7622782 | 7623102 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 39 | 4480574 | 4480855 | - | NZ_CP016353.1 | Prauserella marina |
| 40 | 5354839 | 5355096 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 41 | 1589724 | 1590050 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 42 | 6572381 | 6572707 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 43 | 1088512 | 1088772 | - | NZ_CP022310.1 | Streptomyces calvus |
| 44 | 6532018 | 6532353 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 45 | 5536781 | 5537038 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 46 | 126525 | 126839 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 47 | 135590 | 135904 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 48 | 9373207 | 9373482 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 49 | 6821045 | 6821314 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 50 | 508585 | 508848 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 51 | 2210426 | 2210668 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 52 | 7393265 | 7393588 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 53 | 8298362 | 8298610 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 54 | 7454813 | 7455151 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 55 | 1040349 | 1040663 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 56 | 2687030 | 2687386 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 57 | 5228558 | 5228845 | + | NZ_CP029146.1 | Rhodococcus ruber |
| 58 | 2068651 | 2068956 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 59 | 5222637 | 5222927 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 60 | 543915 | 544205 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 61 | 2442771 | 2443049 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 62 | 155800 | 156078 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 63 | 810648 | 810941 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 64 | 7720507 | 7720767 | + | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 65 | 5009675 | 5009917 | - | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024035.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05121.14 | 0.98 | 60 | 966.0 | same-strand | Gas vesicle protein K |
| 2 | PF00741.20 | 1.0 | 61 | 853 | same-strand | Gas vesicle protein |
| 3 | PF06386.13 | 1.0 | 61 | 561 | same-strand | Gas vesicle synthesis protein GvpL/GvpF |
| 4 | PF05120.14 | 0.95 | 58 | 1651.5 | same-strand | Gas vesicle protein G |
++ More..