Result : O68260
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoyC |
| NCBI Accession ID | AF026147.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3243 |
| Right | 3521 |
| Strand | + |
| Nucleotide Sequence | ATGGACAATGATAAAGAGATAGTGAAAGCCTATGCTTCACTTTGGAATAACCGATCTCTCGCACATGATGACGCAGAAGCGGTAGCAGAGGCGATTGATCTTGAGCTCTTGGATAAACGAACACATCCAAGACTCCGAAAACCGATGCTGGAAAAATATTTTGCCGCGATTCAGCGCATTGTGAATTCACAGCTCGAACCGGCTGTGAAATATCAGCTGGTCAAATTACATACAGAACGTGCAGAGTATTTAAAAGAAGAAAGAGGGGAGCAATCATGA |
| Sequence | MDNDKEIVKAYASLWNNRSLAHDDAEAVAEAIDLELLDKRTHPRLRKPMLEKYFAAIQRIVNSQLEPAVKYQLVKLHTERAEYLKEERGEQS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9734814 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O68260 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2122672 | 2122950 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2065566 | 2065844 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2127686 | 2127964 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2137714 | 2137992 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2213276 | 2213551 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3999507 | 3999785 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2056405 | 2056683 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1871087 | 1871365 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2079349 | 2079621 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2331710 | 2331985 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01554.20 | 1.0 | 10 | 1921.5 | opposite-strand | MatE |
| 2 | PF01740.23 | 0.9 | 9 | 1059 | opposite-strand | STAS domain |
| 3 | PF02585.19 | 1.0 | 10 | 366.5 | same-strand | GlcNAc-PI de-N-acetylase |
| 4 | PF08830.12 | 1.0 | 10 | -3.0 | same-strand | Protein of unknown function (DUF1806) |
| 5 | PF00892.22 | 1.0 | 10 | 75.0 | same-strand | EamA-like transporter family |
| 6 | PF14552.8 | 0.7 | 7 | 2396 | opposite-strand | Tautomerase enzyme |
| 7 | PF01361.23 | 0.7 | 7 | 2396 | opposite-strand | Tautomerase enzyme |
++ More..