Protein Information |
Information Type | Description |
---|---|
Protein name | Flagellar biosynthetic protein FliQ |
NCBI Accession ID | AE000657.1 |
Organism | Aquifex aeolicus (strain VF5) |
Left | 1379313 |
Right | 1379582 |
Strand | - |
Nucleotide Sequence | ATGGAACAGGATTTAATAGTTTCCTTAGGGCAAAGAGCACTTGAAATGACGCTTCTTTTGGCACTTCCCGTATTGCTTTCCACTTTCGTTGTTGGGCTTGTGGTTAGTATATTTCAGGCGGCTACTCAAATTCAGGAAATGACGCTTTCCTATATCCCCAAGGTAATTACCGCATTTCTCGTTATATTTCTCCTCGGCGGCTGGATGATGAGAAAGCTCGTTGACTTTGCAGTTGAGATTTTTGCAAACATTCCCGTATGGATAAGGTAA |
Sequence | MEQDLIVSLGQRALEMTLLLALPVLLSTFVVGLVVSIFQAATQIQEMTLSYIPKVITAFLVIFLLGGWMMRKLVDFAVEIFANIPVWIR |
Source of smORF | Swiss-Prot |
Function | Role in flagellar biosynthesis. {ECO:0000250}. |
Pubmed ID | 9537320 |
Domain | CDD:412617 |
Functional Category | Others |
Uniprot ID | O67774 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1379313 | 1379582 | - | NC_000918.1 | Aquifex aeolicus VF5 |
2 | 1477657 | 1477926 | - | NZ_CP007028.1 | Thermocrinis ruber |
3 | 1061294 | 1061515 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
4 | 1030592 | 1030861 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
5 | 1971619 | 1971888 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
6 | 1255828 | 1256097 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
7 | 3584548 | 3584817 | - | NZ_CP021358.1 | Kushneria marisflavi |
8 | 3306716 | 3306985 | + | NZ_CP021323.1 | Kushneria konosiri |
9 | 2129901 | 2130170 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
10 | 807436 | 807705 | - | NZ_CP058952.1 | Chitinibacter fontanus |
11 | 1411555 | 1411824 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
12 | 3239870 | 3240142 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
13 | 1450323 | 1450592 | + | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
14 | 1144908 | 1145156 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
15 | 1519902 | 1520120 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
16 | 4104843 | 4105061 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
17 | 1734603 | 1734857 | - | NZ_CP024955.1 | Kyrpidia spormannii |
18 | 62651 | 62920 | + | NZ_CP013415.1 | Burkholderia ubonensis |
19 | 1073459 | 1073728 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
20 | 1116657 | 1116926 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
21 | 888705 | 888974 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
22 | 1777418 | 1777687 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
23 | 713553 | 713771 | + | NZ_CP013341.1 | Nitrosomonas ureae |
24 | 633650 | 633919 | - | NZ_CP039288.1 | Cupriavidus necator H16 |
25 | 3875630 | 3875869 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
26 | 2049288 | 2049557 | - | NZ_CP011805.1 | Pelagerythrobacter marensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01311.22 | 0.96 | 25 | 8 | same-strand | Bacterial export proteins, family 1 |
2 | PF00813.22 | 0.85 | 22 | 12.0 | same-strand | FliP family |
3 | PF03748.16 | 0.73 | 19 | 2796 | same-strand | Flagellar basal body-associated protein FliL |
4 | PF02154.17 | 0.73 | 19 | 1799 | same-strand | Flagellar motor switch protein FliM |
5 | PF01052.22 | 0.77 | 20 | 1625 | same-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
6 | PF04347.15 | 0.69 | 18 | 810.0 | same-strand | Flagellar biosynthesis protein, FliO |