Result : O67643
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MPNTRQAKKRMRRDAKRRLRNRYHLSRMRTYIKNFRRMIENGEIDKAKEYINEVISVIYHTAAKGVIHKNEAARRASRVYKLLNKALQQQQAQA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 9537320 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | O67643 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1245234 | 1245518 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 758640 | 758927 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 3 | 1121653 | 1121940 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 4 | 513650 | 513940 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 5 | 1765791 | 1766060 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 6 | 358255 | 358533 | - | NC_012440.1 | Persephonella marina EX-H1 |
++ More..