Result : O67560
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 1153904 |
| Right | 1154200 |
| Strand | - |
| Nucleotide Sequence | ATGTACGCGGTAATAAAAACAGGAGGAAAGCAGTACAAGGTTGAAAAGGGAATGAAGTTAAAGGTAGAAAAGCTCCCTTACGAAGTTGGGCAGACTGTTGAGTTTGAAGCCCTTATGCTTAGGAAAGACGACGGAAGCATAGAGTTCAATAAAGGAAAGGTTATTGCGGAAGTAAAGGCTCACGGCAGAGGAAAAAAATTAATAGTTTTTAAGTACAGACCTAAGAAAAACTACAAAAGGTGGAAGGGTCATAGACAGCCCTATACTGAAATAGAGATAAAAGACATACTCCCCTAA |
| Sequence | MYAVIKTGGKQYKVEKGMKLKVEKLPYEVGQTVEFEALMLRKDDGSIEFNKGKVIAEVKAHGRGKKLIVFKYRPKKNYKRWKGHRQPYTEIEIKDILP |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | 9537320 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | O67560 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 116
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1153904 | 1154200 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 1428341 | 1428643 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 3 | 1488674 | 1488973 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 4 | 1297358 | 1297657 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 5 | 50271 | 50564 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 6 | 1542291 | 1542581 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 7 | 977148 | 977459 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 8 | 1991228 | 1991539 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 9 | 1552941 | 1553252 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 10 | 121162 | 121470 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 11 | 239491 | 239796 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 12 | 739410 | 739715 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 13 | 251560 | 251850 | + | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 14 | 1214249 | 1214554 | + | NZ_CP016312.1 | Thermus brockianus |
| 15 | 257030 | 257338 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 16 | 2444555 | 2444866 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 17 | 1668295 | 1668600 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 18 | 578262 | 578558 | + | NC_013515.1 | Streptobacillus moniliformis DSM 12112 |
| 19 | 1163636 | 1163947 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 20 | 1613664 | 1613975 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 21 | 2695655 | 2695966 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 22 | 175643 | 175951 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 23 | 327207 | 327512 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 24 | 1036964 | 1037278 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 25 | 3111624 | 3111938 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 26 | 752712 | 753026 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 27 | 912954 | 913268 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 28 | 1588784 | 1589095 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 29 | 973881 | 974192 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 30 | 554958 | 555269 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 31 | 1653975 | 1654286 | - | NZ_HG917868.1 | Clostridium bornimense |
| 32 | 1322236 | 1322547 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 33 | 3356912 | 3357223 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 34 | 1464835 | 1465149 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 35 | 1590080 | 1590388 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 36 | 921119 | 921433 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 37 | 3901940 | 3902248 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 38 | 928656 | 928970 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 39 | 1293968 | 1294279 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 40 | 174867 | 175172 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 41 | 235472 | 235777 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 42 | 487433 | 487744 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 43 | 87338 | 87649 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 44 | 1186224 | 1186532 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 45 | 554579 | 554893 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 46 | 2720913 | 2721224 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 47 | 3128847 | 3129155 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 48 | 3185246 | 3185557 | - | NZ_CP030775.1 | Clostridium butyricum |
| 49 | 2062888 | 2063196 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 50 | 1828745 | 1829053 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 51 | 1441503 | 1441814 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 52 | 2369841 | 2370155 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 53 | 276017 | 276325 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 54 | 1471529 | 1471837 | - | NZ_CP047361.1 | Macrococcus canis |
| 55 | 1763134 | 1763445 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 56 | 2615781 | 2616089 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 57 | 188808 | 189119 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 58 | 3383964 | 3384278 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 59 | 2475620 | 2475928 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 60 | 3150492 | 3150806 | - | NZ_CP028842.1 | Clostridium botulinum |
| 61 | 3065469 | 3065783 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 62 | 815835 | 816149 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 63 | 2828872 | 2829180 | + | NZ_CP043404.1 | Bacillus safensis |
| 64 | 1277950 | 1278264 | + | NZ_CP040924.1 | Clostridium thermarum |
| 65 | 4220773 | 4221096 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 66 | 2654330 | 2654641 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 67 | 1508757 | 1509068 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 68 | 1926406 | 1926720 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 69 | 1970183 | 1970491 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 70 | 315852 | 316163 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 71 | 1224219 | 1224533 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
| 72 | 1104443 | 1104757 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 73 | 879946 | 880257 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 74 | 1554744 | 1555052 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 75 | 548047 | 548355 | + | NZ_CP059563.1 | Conchiformibius steedae |
| 76 | 1825802 | 1826110 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 77 | 1194455 | 1194763 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 78 | 3324560 | 3324829 | - | NZ_CP041046.1 | Luteibacter pinisoli |
| 79 | 1610859 | 1611167 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 80 | 1576747 | 1577055 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 81 | 3353772 | 3354080 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 82 | 1489321 | 1489629 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 83 | 1553869 | 1554177 | - | NZ_LT906444.1 | Listeria welshimeri |
| 84 | 676478 | 676789 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 85 | 4415395 | 4415703 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 86 | 986219 | 986530 | + | NZ_CP034118.1 | Staphylospora marina |
| 87 | 984891 | 985202 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 88 | 137175 | 137486 | + | NZ_LR134420.1 | Legionella adelaidensis |
| 89 | 662312 | 662611 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 90 | 3670554 | 3670865 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 91 | 1784336 | 1784647 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 92 | 1218080 | 1218388 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 93 | 977452 | 977760 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 94 | 4078294 | 4078623 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 95 | 2804618 | 2804926 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 96 | 1213549 | 1213857 | - | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 97 | 1358047 | 1358355 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
| 98 | 3653870 | 3654181 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 99 | 1568508 | 1568822 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 100 | 1401287 | 1401595 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 101 | 2233413 | 2233715 | - | NZ_CP059569.1 | Kingella oralis |
| 102 | 2123099 | 2123413 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 103 | 1542526 | 1542813 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 104 | 11042849 | 11043157 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 105 | 626186 | 626494 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 106 | 3859877 | 3860185 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 107 | 928508 | 928819 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 108 | 3624826 | 3625140 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 109 | 4485032 | 4485346 | - | NZ_CP020953.1 | Clostridium drakei |
| 110 | 5394346 | 5394660 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 111 | 1404516 | 1404827 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 112 | 287955 | 288263 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 113 | 2354690 | 2355004 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 114 | 1852750 | 1853064 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 115 | 1357777 | 1358088 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 116 | 395566 | 395877 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019699.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01016.21 | 0.99 | 115 | 335 | same-strand | Ribosomal L27 protein |
| 2 | PF04327.14 | 0.66 | 77 | 6 | same-strand | Cysteine protease Prp |
| 3 | PF01018.24 | 0.64 | 74 | 952.0 | same-strand | GTP1/OBG |
| 4 | PF01926.25 | 0.66 | 76 | 952.0 | same-strand | 50S ribosome-binding GTPase |
++ More..