Protein Information |
Information Type | Description |
---|---|
Protein name | Ferredoxin oxidoreductase 1 subunit ForD (EC 1.-.-.-) (Ferredoxin oxidoreductase 1 subunit delta) |
NCBI Accession ID | AE000657.1 |
Organism | Aquifex aeolicus (strain VF5) |
Left | 839920 |
Right | 840159 |
Strand | + |
Nucleotide Sequence | ATGTACTACGTTGCTCAAGTCATTAAAGATGAATGTTCAAAATACAACTGTAAGCAGTGTACCCTCTTTTGTCCCGAGCCTAATACTTTGATGTACACAGATGAAGGTCACCACGCTTACGTTAATACCTTGAGGTGCAAAGGTTGTGCCCTTTGCGTTTACGTGTGTTCTGAGCTCTTGAAGCGTGATTCCATTGAGATGGTTTACGCGGAAAACAGAGACGTTGCAGGTGTAAGGTAA |
Sequence | MYYVAQVIKDECSKYNCKQCTLFCPEPNTLMYTDEGHHAYVNTLRCKGCALCVYVCSELLKRDSIEMVYAENRDVAGVR |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9537320 |
Domain | |
Functional Category | Metal-binding |
Uniprot ID | O67251 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 839920 | 840159 | + | NC_000918.1 | Aquifex aeolicus VF5 |
2 | 822528 | 822764 | + | NC_000918.1 | Aquifex aeolicus VF5 |
3 | 1389149 | 1389379 | - | NZ_CP007028.1 | Thermocrinis ruber |
4 | 1181389 | 1181613 | + | NZ_CP007028.1 | Thermocrinis ruber |
5 | 753486 | 753716 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
6 | 628232 | 628456 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
7 | 1419370 | 1419600 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
8 | 1002973 | 1003197 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
9 | 588428 | 588664 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
10 | 579629 | 579859 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02552.18 | 1.0 | 5 | 1402.0 | same-strand | CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit |
2 | PF01855.21 | 1.0 | 5 | 1586 | same-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
3 | PF17147.6 | 1.0 | 5 | 1136 | same-strand | Pyruvate:ferredoxin oxidoreductase core domain II |
4 | PF02775.23 | 1.0 | 5 | 798 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
5 | PF01558.20 | 1.0 | 5 | 2695 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
6 | PF02780.22 | 1.0 | 5 | 1596 | same-strand | Transketolase, C-terminal domain |
7 | PF02492.21 | 0.8 | 4 | 305.5 | same-strand | CobW/HypB/UreG, nucleotide-binding domain |
8 | PF10070.11 | 0.6 | 3 | 3478 | same-strand | Na+-translocating membrane potential-generating system (MpsB) |
9 | PF02641.17 | 0.6 | 3 | 6459 | same-strand | Uncharacterized ACR, COG1993 |