Result : O67242

Protein Information

• Protein name: Flagellar hook-basal body complex protein FliE
• NCBI Accession ID: AE000657.1
• Organism: Aquifex aeolicus (strain VF5)
• Left: 832066
• Right: 832347
• Strand: -
• Nucleotide Sequence: ATGGAAGTAGGAAAACTCGGTTTTATACCAAAATTATTTGAAGTCCAACAAAACGTGAAGGGAGAGGATATAGTTGAGAACTTCGTAAATTTCGTGGAGTGGGTGAACGAAAAGCAGTTAAAGTCAAAGAAGCTAAAAGAGGCGGTATTGGAGGGAAGAGACGTTCCTCTTCACGAGATAGTTATAGAAGCGGAAAAGGCAAAGGTAGCCCTGAACCTTCTCATAGAGGTAAGGAATAAACTATTAGAAGCTTACAACGAACTTATGAAGATGCAAGTTTAG
• Sequence: MEVGKLGFIPKLFEVQQNVKGEDIVENFVNFVEWVNEKQLKSKKLKEAVLEGRDVPLHEIVIEAEKAKVALNLLIEVRNKLLEAYNELMKMQV
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl09139. Profile Description: Flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction. [Cellular processes, Chemotaxis and motility]
• Pubmed ID: 9537320
• Domain: CDD:415593
• Functional Category: Others
• Uniprot ID: O67242
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	832066	832347	-	NC_000918.1	Aquifex aeolicus VF5
2	614894	615175	+	NZ_CP007028.1	Thermocrinis ruber

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000918.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01514.19	1.0	2	3.0	same-strand	Secretory protein of YscJ/FliF family
2	PF08345.13	1.0	2	376.5	same-strand	Flagellar M-ring protein C-terminal