Result : O67028
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 600393 |
| Right | 600596 |
| Strand | - |
| Nucleotide Sequence | TTGGTTACGGTAATTGTTCAGGAAGGAGAACCTATAGAGAAGGTTTTAAAGAGGTTCAAGGCAAGAGTTGAGCAGGAACAAATTTTGACCGAGTTAAAGAGGAGAGAGTACTACGAGCCACCGAGTGAAAGGAAGAAGAAAAGGGAGAGGAACAGGAGAAAGAAGATATTAAAAGCCCTCAAAAAACAACAACAACTCATCTAA |
| Sequence | MVTVIVQEGEPIEKVLKRFKARVEQEQILTELKRREYYEPPSERKKKRERNRRKKILKALKKQQQLI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 9537320 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | O67028 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 600393 | 600596 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 53767 | 53967 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 3 | 475535 | 475762 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 4 | 1264002 | 1264202 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 5 | 121683 | 121883 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 6 | 1277705 | 1277914 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 7 | 1404218 | 1404418 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 8 | 2062353 | 2062550 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 9 | 694690 | 694884 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 10 | 1431030 | 1431245 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 11 | 905608 | 905784 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 12 | 1130942 | 1131142 | + | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
++ More..