Result : O66570
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 113301 |
| Right | 113531 |
| Strand | - |
| Nucleotide Sequence | ATGTCAAGGAGACCTAAGATAGAGGAAGCTATGAAAAGGGTTGAGTCCCGCTATGAACTCGTGCACGCAGCCGTAAGGAGAACGCTTCAGCTCCTCAGGGAAGGAGAGGACTTTTTTGTCCAGGAAGGGGGAGAGGTTCACAAAAAAACCTTCGCAGCAATAGAAGATATTGCGGAAGGGAAGGTAAAGATAATAAAGAAAAAGGAAGAAAGTGGAAGTAAAGAAGAATGA |
| Sequence | MSRRPKIEEAMKRVESRYELVHAAVRRTLQLLREGEDFFVQEGGEVHKKTFAAIEDIAEGKVKIIKKKEESGSKEE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}. |
| Pubmed ID | 9537320 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | O66570 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 113301 | 113531 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 451624 | 451848 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 3 | 911563 | 911790 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 4 | 209545 | 209766 | - | NZ_CP007028.1 | Thermocrinis ruber |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013894.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01464.22 | 0.75 | 3 | 389 | same-strand | Transglycosylase SLT domain |
| 2 | PF00202.23 | 0.75 | 3 | 2030 | opposite-strand | Aminotransferase class-III |
++ More..