Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AE000657.1 |
Organism | Aquifex aeolicus (strain VF5) |
Left | 113301 |
Right | 113531 |
Strand | - |
Nucleotide Sequence | ATGTCAAGGAGACCTAAGATAGAGGAAGCTATGAAAAGGGTTGAGTCCCGCTATGAACTCGTGCACGCAGCCGTAAGGAGAACGCTTCAGCTCCTCAGGGAAGGAGAGGACTTTTTTGTCCAGGAAGGGGGAGAGGTTCACAAAAAAACCTTCGCAGCAATAGAAGATATTGCGGAAGGGAAGGTAAAGATAATAAAGAAAAAGGAAGAAAGTGGAAGTAAAGAAGAATGA |
Sequence | MSRRPKIEEAMKRVESRYELVHAAVRRTLQLLREGEDFFVQEGGEVHKKTFAAIEDIAEGKVKIIKKKEESGSKEE |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}. |
Pubmed ID | 9537320 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | O66570 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 113301 | 113531 | - | NC_000918.1 | Aquifex aeolicus VF5 |
2 | 451624 | 451848 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
3 | 911563 | 911790 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
4 | 209545 | 209766 | - | NZ_CP007028.1 | Thermocrinis ruber |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01464.22 | 0.75 | 3 | 389 | same-strand | Transglycosylase SLT domain |
2 | PF00202.23 | 0.75 | 3 | 2030 | opposite-strand | Aminotransferase class-III |