Result : O66564
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 109189 |
| Right | 109491 |
| Strand | - |
| Nucleotide Sequence | GTGATGAAGAGGTTAATGGCTATCTTAACCGCTATAATGCCTGCTATAGCAATGGCAGCGGAAGGAGAGGCTTCCGTAGCTAAGGGACTTCTGTACCTTGGAGCAGGACTTGCTATAGGGCTTGCAGGACTCGGTGCCGGAGTTGGTATGGGTCATGCCGTTAGGGGAACTCAGGAAGGTGTTGCGAGGAATCCCAACGCAGGCGGAAGACTTCAAACCCTTATGTTCATAGGACTTGCGTTTATAGAAACTATCGCTCTTTACGGATTGCTCATAGCTTTCATACTGCTCTTCGTGGTTTAA |
| Sequence | MMKRLMAILTAIMPAIAMAAEGEASVAKGLLYLGAGLAIGLAGLGAGVGMGHAVRGTQEGVARNPNAGGRLQTLMFIGLAFIETIALYGLLIAFILLFVV |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 9537320 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | O66564 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 109189 | 109491 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 1104685 | 1104990 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 3 | 160237 | 160485 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 4 | 1257721 | 1258029 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 5 | 515216 | 515497 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 6 | 1369606 | 1369905 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 7 | 3379171 | 3379443 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000918.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00119.22 | 1.0 | 7 | 72 | same-strand | ATP synthase A chain |
++ More..