Result : O66563
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L34 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 109002 |
| Right | 109145 |
| Strand | - |
| Nucleotide Sequence | ATGGTAACCGAAGGATTAAAACCGCATATATCTATAAAAAAGAAGAAGAGAAAGAGCGGATTTCTCGCAAGAATGAGAACGAAGTCTGGAAGGAAGATCATAGCCAGAAGGAGGAGAAAAGGCAGGAAGAGACTCGCTCCTTAA |
| Sequence | MVTEGLKPHISIKKKKRKSGFLARMRTKSGRKIIARRRRKGRKRLAP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9537320 |
| Domain | |
| Functional Category | Ribosomal_protein |
| Uniprot ID | O66563 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 134
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 109002 | 109145 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 160526 | 160672 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 3 | 952158 | 952292 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 4 | 3059653 | 3059790 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 5 | 174931 | 175074 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 6 | 3403024 | 3403173 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 7 | 1309037 | 1309171 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 8 | 744627 | 744761 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 9 | 169274 | 169408 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 10 | 815378 | 815512 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 11 | 8417156 | 8417305 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 12 | 448917 | 449051 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 13 | 441827 | 441961 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 14 | 5690575 | 5690724 | + | NZ_CP016211.1 | Minicystis rosea |
| 15 | 564534 | 564668 | + | NZ_CP059443.1 | Campylobacter fetus |
| 16 | 4214134 | 4214268 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 17 | 1195752 | 1195886 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 18 | 769860 | 769994 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 19 | 462263 | 462397 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 20 | 1193100 | 1193234 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 21 | 745248 | 745382 | + | NZ_CP012541.1 | Campylobacter concisus |
| 22 | 5424320 | 5424478 | - | NZ_CP012333.1 | Labilithrix luteola |
| 23 | 1428878 | 1429012 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 24 | 1755867 | 1756001 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 25 | 1887788 | 1887922 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 26 | 1087009 | 1087143 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 27 | 1167343 | 1167477 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 28 | 258363 | 258500 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 29 | 2347113 | 2347250 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 30 | 243576 | 243719 | - | NZ_CP068345.1 | Succinivibrio dextrinosolvens |
| 31 | 147353 | 147487 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 32 | 1475180 | 1475314 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 33 | 160804 | 160938 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 34 | 860334 | 860468 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 35 | 1154198 | 1154332 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 36 | 1146738 | 1146872 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 37 | 2614958 | 2615092 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 38 | 5269856 | 5269990 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 39 | 5658079 | 5658213 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 40 | 6037636 | 6037770 | - | NZ_CP009288.1 | Paenibacillus durus |
| 41 | 303517 | 303651 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 42 | 1183897 | 1184031 | - | NZ_CP053826.1 | Campylobacter curvus |
| 43 | 1440070 | 1440207 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 44 | 1662169 | 1662303 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 45 | 583504 | 583638 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 46 | 1987557 | 1987712 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 47 | 983964 | 984098 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 48 | 385622 | 385756 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 49 | 901364 | 901498 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 50 | 6397794 | 6397928 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 51 | 357756 | 357902 | - | NZ_CP034044.1 | Mycoplasma struthionis |
| 52 | 416336 | 416470 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 53 | 3222293 | 3222427 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 54 | 1462860 | 1462994 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 55 | 90879 | 91013 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 56 | 2084764 | 2084904 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 57 | 1169519 | 1169653 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 58 | 1443597 | 1443734 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 59 | 1546394 | 1546528 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 60 | 114350 | 114484 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 61 | 3231270 | 3231404 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 62 | 6493286 | 6493420 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 63 | 3782405 | 3782539 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 64 | 527465 | 527599 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 65 | 542326 | 542460 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 66 | 551521 | 551655 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 67 | 544448 | 544582 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 68 | 494733 | 494867 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 69 | 1242502 | 1242636 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 70 | 7061184 | 7061318 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 71 | 3989448 | 3989582 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 72 | 1326980 | 1327114 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 73 | 1447499 | 1447633 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 74 | 1291294 | 1291428 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 75 | 1683026 | 1683160 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 76 | 1763316 | 1763450 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 77 | 1966784 | 1966918 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 78 | 2159955 | 2160089 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 79 | 1911342 | 1911476 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 80 | 7165744 | 7165878 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 81 | 1869523 | 1869657 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 82 | 7918767 | 7918901 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 83 | 2175499 | 2175633 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 84 | 3033681 | 3033815 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 85 | 1027411 | 1027545 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 86 | 547287 | 547421 | + | NZ_CP026363.1 | Brevibacillus agri |
| 87 | 2042515 | 2042649 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 88 | 2118503 | 2118637 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 89 | 553783 | 553917 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 90 | 2277370 | 2277504 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 91 | 5657840 | 5657974 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 92 | 1597718 | 1597852 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 93 | 2005566 | 2005700 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 94 | 2263476 | 2263610 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 95 | 2311974 | 2312108 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 96 | 734239 | 734373 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 97 | 894782 | 894916 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 98 | 4680956 | 4681093 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 99 | 2272857 | 2272991 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 100 | 522437 | 522571 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 101 | 4185850 | 4185984 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 102 | 3780383 | 3780517 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 103 | 1838151 | 1838288 | - | NC_010571.1 | Opitutus terrae PB90-1 |
| 104 | 3554098 | 3554226 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 105 | 2042815 | 2042949 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 106 | 2118664 | 2118798 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 107 | 6726281 | 6726415 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 108 | 4242820 | 4242954 | - | NZ_CP033433.1 | Cohnella candidum |
| 109 | 353854 | 353988 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 110 | 5378479 | 5378613 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 111 | 1910876 | 1911010 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 112 | 2128942 | 2129076 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 113 | 1078700 | 1078843 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 114 | 2108346 | 2108480 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 115 | 873687 | 873827 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 116 | 8156022 | 8156156 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 117 | 1444562 | 1444699 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 118 | 1545409 | 1545543 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 119 | 1104532 | 1104675 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 120 | 237319 | 237453 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 121 | 941088 | 941222 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 122 | 320353 | 320487 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 123 | 117315 | 117449 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 124 | 2263591 | 2263725 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 125 | 1297588 | 1297722 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 126 | 650232 | 650366 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 127 | 1426921 | 1427058 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 128 | 1258040 | 1258183 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 129 | 816275 | 816430 | - | NZ_CP023777.1 | Chitinophaga caeni |
| 130 | 5233952 | 5234107 | + | NZ_CP048113.1 | Chitinophaga agri |
| 131 | 1263867 | 1264022 | + | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
| 132 | 1167854 | 1167991 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 133 | 723247 | 723381 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 134 | 1223178 | 1223312 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022847.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.96 | 128 | 658.0 | same-strand | 60Kd inner membrane protein |
| 2 | PF12631.9 | 0.78 | 105 | 3064 | same-strand | MnmE helical domain |
| 3 | PF10396.11 | 0.76 | 102 | 3058.5 | same-strand | GTP-binding protein TrmE N-terminus |
| 4 | PF01926.25 | 0.78 | 105 | 3064.0 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF14804.8 | 0.8 | 107 | 2232 | same-strand | Jag N-terminus |
++ More..