Result : O66524
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0109 protein aq_124 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 78663 |
| Right | 78902 |
| Strand | + |
| Nucleotide Sequence | ATGAGCGCACTCAAGGACATTGTTGAACTCACAGCAAAAGAATTAGTAGACAACAAGGACAAAGTGAGAGTTACCGAGATTGAAGGAGAAAAGACCGTTGTAATTGAGCTCAGGGTTGACCCTGCTGAGCTCGGTAAGGTTATCGGAAAGCAGGGTAGGATCGCAAGAGCTCTCAGAACCATCCTCACCGCAATCGGTAGAAAGATAGGAAAGAGGGTGGTTCTGGAAATACTTGAGTAA |
| Sequence | MSALKDIVELTAKELVDNKDKVRVTEIEGEKTVVIELRVDPAELGKVIGKQGRIARALRTILTAIGRKIGKRVVLEILE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00098. Profile Description: K homology (KH) RNA-binding domain, type I. Rrp40, also called exosome component 3 (EXOSC3), or ribosomal RNA-processing protein 40, is a non-catalytic component of the RNA exosome complex which has 3'-->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. Mutations of EXOSC3 gene are associated with neurological diseases. Members in this subfamily contain a divergent KH domain that lacks the RNA-binding GXXG motif. |
| Pubmed ID | 9537320 |
| Domain | CDD:412160 |
| Functional Category | RNA-binding |
| Uniprot ID | O66524 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 219
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 78663 | 78902 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 1546246 | 1546485 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 3 | 462991 | 463230 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 4 | 355989 | 356228 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 5 | 1276959 | 1277198 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 6 | 1347436 | 1347675 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 7 | 2090704 | 2090901 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 8 | 2084640 | 2084846 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 9 | 124899 | 125138 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 10 | 1449539 | 1449772 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 11 | 1615808 | 1616038 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 12 | 3741904 | 3742101 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 13 | 1121217 | 1121450 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 14 | 2293071 | 2293304 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 15 | 861253 | 861486 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 16 | 1652759 | 1652992 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 17 | 1786134 | 1786367 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 18 | 1023113 | 1023346 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 19 | 1872142 | 1872375 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 20 | 1073264 | 1073497 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 21 | 4043247 | 4043486 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 22 | 387344 | 387583 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 23 | 2411058 | 2411291 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 24 | 1058165 | 1058395 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 25 | 3904591 | 3904821 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 26 | 3012173 | 3012367 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 27 | 2810244 | 2810453 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 28 | 2617136 | 2617333 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 29 | 3135815 | 3136054 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 30 | 212250 | 212480 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 31 | 2159265 | 2159504 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 32 | 3702409 | 3702603 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 33 | 3747161 | 3747355 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 34 | 3913831 | 3914043 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 35 | 565653 | 565886 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 36 | 842515 | 842709 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 37 | 410300 | 410533 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 38 | 1305723 | 1305962 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 39 | 5374758 | 5374997 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 40 | 705841 | 706080 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 41 | 1214405 | 1214638 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 42 | 323221 | 323451 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 43 | 1169847 | 1170092 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 44 | 815508 | 815747 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 45 | 2619695 | 2619889 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 46 | 1794629 | 1794823 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 47 | 2319094 | 2319288 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 48 | 705170 | 705403 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 49 | 1884333 | 1884572 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 50 | 873196 | 873426 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 51 | 2208088 | 2208318 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 52 | 3505655 | 3505852 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 53 | 81499 | 81738 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 54 | 2032206 | 2032439 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 55 | 931368 | 931562 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 56 | 2189515 | 2189745 | - | NZ_CP061799.1 | Desulfonema limicola |
| 57 | 1290217 | 1290450 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 58 | 6750974 | 6751204 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 59 | 6559151 | 6559381 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 60 | 2377538 | 2377732 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 61 | 2196388 | 2196618 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 62 | 3932517 | 3932747 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 63 | 3537001 | 3537231 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 64 | 2794918 | 2795139 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 65 | 436424 | 436654 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 66 | 6455347 | 6455541 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 67 | 6131484 | 6131714 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 68 | 490486 | 490683 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 69 | 2825922 | 2826116 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 70 | 3129796 | 3130035 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 71 | 4286370 | 4286564 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 72 | 4219935 | 4220129 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 73 | 2216828 | 2217058 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 74 | 1278815 | 1279054 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 75 | 5757006 | 5757236 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 76 | 1391632 | 1391865 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 77 | 1181035 | 1181265 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 78 | 2301159 | 2301389 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 79 | 2287595 | 2287792 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 80 | 535506 | 535739 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 81 | 2322478 | 2322675 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 82 | 1442725 | 1442952 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 83 | 1193522 | 1193749 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 84 | 3519208 | 3519438 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 85 | 1852231 | 1852425 | + | NC_023035.1 | Salinispira pacifica |
| 86 | 1396684 | 1396911 | + | NZ_CP043998.1 | Clostridium diolis |
| 87 | 2574031 | 2574261 | + | NZ_CP061800.1 | Desulfonema magnum |
| 88 | 943982 | 944212 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 89 | 1186150 | 1186377 | + | NZ_CP020953.1 | Clostridium drakei |
| 90 | 3081830 | 3082057 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 91 | 257157 | 257387 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 92 | 3625733 | 3625960 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 93 | 1389677 | 1389904 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 94 | 1251506 | 1251733 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 95 | 147423 | 147650 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 96 | 596683 | 596916 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 97 | 2873073 | 2873303 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 98 | 187728 | 187967 | - | NZ_CP023671.1 | Clostridium septicum |
| 99 | 1056680 | 1056910 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 100 | 1844551 | 1844778 | + | NZ_CP040924.1 | Clostridium thermarum |
| 101 | 543800 | 543994 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 102 | 1104765 | 1104998 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 103 | 793560 | 793793 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 104 | 2250539 | 2250766 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 105 | 2100855 | 2101082 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 106 | 2028898 | 2029137 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 107 | 1047283 | 1047510 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 108 | 1905379 | 1905615 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 109 | 1200557 | 1200784 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 110 | 1420236 | 1420478 | + | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 111 | 2993507 | 2993749 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 112 | 1486976 | 1487203 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 113 | 1879049 | 1879279 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 114 | 1759883 | 1760113 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 115 | 1767225 | 1767422 | - | NZ_CP054142.1 | Treponema parvum |
| 116 | 1055514 | 1055741 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 117 | 2140467 | 2140697 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 118 | 1425843 | 1426037 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 119 | 946577 | 946795 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 120 | 2526999 | 2527226 | - | NZ_CP028842.1 | Clostridium botulinum |
| 121 | 2789485 | 2789712 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 122 | 1010854 | 1011087 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 123 | 1413377 | 1413583 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 124 | 1951490 | 1951705 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 125 | 1574135 | 1574362 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 126 | 1574236 | 1574466 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 127 | 1219348 | 1219566 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 128 | 1442360 | 1442590 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 129 | 911979 | 912209 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 130 | 4812860 | 4813090 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 131 | 1166504 | 1166743 | - | NZ_CP016786.1 | Clostridium isatidis |
| 132 | 1058094 | 1058291 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 133 | 1822407 | 1822634 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 134 | 2431802 | 2432032 | + | NZ_CP039126.1 | Blautia producta |
| 135 | 3683085 | 3683324 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 136 | 3401680 | 3401907 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 137 | 2378771 | 2378998 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 138 | 58802 | 59029 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 139 | 3001069 | 3001299 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 140 | 1700180 | 1700410 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 141 | 2016243 | 2016485 | + | NZ_CP019914.1 | Brachyspira hampsonii |
| 142 | 1286337 | 1286579 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 143 | 3730541 | 3730735 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 144 | 2129425 | 2129652 | - | NZ_CP009687.1 | Clostridium aceticum |
| 145 | 1117464 | 1117694 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 146 | 2184826 | 2185020 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 147 | 2009451 | 2009681 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 148 | 2128590 | 2128820 | - | NZ_LR699011.1 | Roseburia hominis |
| 149 | 790995 | 791222 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 150 | 1061952 | 1062170 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 151 | 2496316 | 2496546 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 152 | 1432508 | 1432741 | - | NZ_CP009228.1 | Treponema putidum |
| 153 | 901589 | 901822 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 154 | 1302698 | 1302928 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 155 | 3434486 | 3434704 | + | NZ_CP021434.1 | Tumebacillus avium |
| 156 | 2673142 | 2673372 | - | NC_014624.2 | Eubacterium callanderi |
| 157 | 4300000 | 4300230 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 158 | 3103262 | 3103492 | + | NZ_CP019962.1 | Eubacterium limosum |
| 159 | 3290318 | 3290548 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 160 | 1945705 | 1945935 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 161 | 6385927 | 6386157 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 162 | 1715469 | 1715705 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 163 | 173706 | 173954 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 164 | 1472409 | 1472627 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 165 | 2761250 | 2761480 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 166 | 301781 | 302011 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 167 | 2254782 | 2254979 | + | NZ_CP031518.1 | Treponema ruminis |
| 168 | 1241009 | 1241239 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 169 | 1987748 | 1987984 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 170 | 1208494 | 1208724 | + | NZ_LN879430.1 | Herbinix luporum |
| 171 | 1405817 | 1406044 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 172 | 1482717 | 1482944 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 173 | 2640928 | 2641122 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 174 | 1688385 | 1688612 | - | NZ_CP014204.2 | Clostridium baratii |
| 175 | 2931500 | 2931718 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 176 | 1228584 | 1228814 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 177 | 1278244 | 1278483 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 178 | 1416594 | 1416821 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 179 | 1713376 | 1713606 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 180 | 9200557 | 9200751 | + | NZ_CP012333.1 | Labilithrix luteola |
| 181 | 1403722 | 1403949 | - | NC_008593.1 | Clostridium novyi NT |
| 182 | 1807028 | 1807255 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 183 | 1425547 | 1425774 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 184 | 2599937 | 2600164 | + | NZ_CP026363.1 | Brevibacillus agri |
| 185 | 3087909 | 3088139 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 186 | 2388553 | 2388780 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 187 | 1280051 | 1280278 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 188 | 1307487 | 1307714 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 189 | 1419012 | 1419239 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 190 | 3258498 | 3258725 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 191 | 2343074 | 2343304 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 192 | 307563 | 307796 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 193 | 2268262 | 2268489 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 194 | 2786125 | 2786352 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 195 | 2165262 | 2165489 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 196 | 1303307 | 1303534 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 197 | 1281509 | 1281736 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 198 | 1377157 | 1377375 | + | NZ_CP048649.1 | Aminipila butyrica |
| 199 | 3238907 | 3239137 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 200 | 1433348 | 1433575 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 201 | 3795994 | 3796224 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 202 | 3737265 | 3737459 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 203 | 4880561 | 4880791 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 204 | 3885379 | 3885609 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 205 | 2746780 | 2747010 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 206 | 1126951 | 1127181 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 207 | 4652988 | 4653218 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 208 | 2165621 | 2165851 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 209 | 1385180 | 1385404 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 210 | 613765 | 613995 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 211 | 2567324 | 2567521 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 212 | 1439602 | 1439832 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 213 | 552190 | 552417 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 214 | 2015455 | 2015685 | - | NZ_CP030280.1 | Blautia argi |
| 215 | 868953 | 869186 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 216 | 253631 | 253861 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 217 | 270516 | 270746 | + | NZ_CP070062.1 | Coprococcus comes |
| 218 | 1818233 | 1818481 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 219 | 4803763 | 4803975 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 220 | 4990019 | 4990231 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 221 | 1695487 | 1695735 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 222 | 5894603 | 5894815 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 223 | 6083437 | 6083649 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 224 | 2236451 | 2236663 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 225 | 6019482 | 6019694 | + | NZ_CP070242.1 | Streptomyces californicus |
| 226 | 6076547 | 6076759 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 227 | 755274 | 755468 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 228 | 739866 | 740114 | + | NZ_CP028861.1 | Borreliella garinii |
| 229 | 734513 | 734761 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 230 | 734685 | 734933 | + | NZ_CP044535.1 | Borrelia maritima |
| 231 | 737791 | 738039 | + | NZ_CP015796.1 | Borreliella mayonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015672.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00886.21 | 1.0 | 219 | 30.0 | same-strand | Ribosomal protein S16 |
| 2 | PF00448.24 | 0.91 | 199 | 383.5 | same-strand | SRP54-type protein, GTPase domain |
| 3 | PF02978.21 | 0.91 | 199 | 346.0 | same-strand | Signal peptide binding domain |
| 4 | PF02881.21 | 0.91 | 199 | 383.5 | same-strand | SRP54-type protein, helical bundle domain |
| 5 | PF01245.22 | 0.84 | 183 | 1546.0 | same-strand | Ribosomal protein L19 |
| 6 | PF01746.23 | 0.91 | 199 | 588.5 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 7 | PF01782.20 | 0.95 | 208 | 51 | same-strand | RimM N-terminal domain |
| 8 | PF05239.18 | 0.8 | 176 | 63 | same-strand | PRC-barrel domain |
++ More..