Result : O66505
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein-export membrane protein SecG |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 61696 |
| Right | 61998 |
| Strand | + |
| Nucleotide Sequence | ATGTACTACGCTCTCCTTACACTATTCGTAATAATTGCAGTTGTACTCATTATCTCCACGCTCCTTCAAAAGGGAAGGGGAGACGTCGGTGCGGCTTTCGGCGGTGGTATGGGGCAGTCCATATTCGGCGTCGGCGGAGTTGAGACTATCCTCACAAAAGCCACTTACTGGCTTGGAGCACTCTTTTTAGTCCTTGCACTCCTTCTTTCGGTCATTCCAAAGGAAAAGGGTTCTGTAGTTGAGAAAAGTGTTCAAACTGAACAAAGTGAAGGTAAAGGAACTACTCAAGAAAGTGGAAAGTGA |
| Sequence | MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGALFLVLALLLSVIPKEKGSVVEKSVQTEQSEGKGTTQESGK |
| Source of smORF | Swiss-Prot |
| Function | Subunit of the protein translocation channel SecYEG. |
| Pubmed ID | 9537320 18923516 |
| Domain | CDD:415590 |
| Functional Category | Others |
| Uniprot ID | O66505 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 61696 | 61998 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 590210 | 590548 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 3 | 863682 | 864020 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 4 | 45061 | 45399 | - | NZ_CP007028.1 | Thermocrinis ruber |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000918.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01595.22 | 1.0 | 4 | 709.0 | same-strand | Cyclin M transmembrane N-terminal domain |
| 2 | PF03471.19 | 1.0 | 4 | 709.0 | same-strand | Transporter associated domain |
| 3 | PF00571.30 | 1.0 | 4 | 709 | same-strand | CBS domain |
++ More..