Result : O66492
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 50396 |
| Right | 50605 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGATAGTGAGATTTGTGGAAAGAGACCTGTTGTCGGAAGGAGAGTCACCTTATCGGGTGAGAGGAACAGAAGGATTTTTAAACCGAACGTCCATAAGATGAGGGTAATGCTCCCGGATGGAACGGTAAAGAGGATGTACGTGTGCACCAAGTGCCTCAAGGCGGGTAAGGTAATGAAAGCACCCAGAATTCCCAAGGAAGGTTAA |
| Sequence | MADSEICGKRPVVGRRVTLSGERNRRIFKPNVHKMRVMLPDGTVKRMYVCTKCLKAGKVMKAPRIPKEG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 9537320 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | O66492 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 50396 | 50605 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 813682 | 813882 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 3 | 218864 | 219064 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 4 | 87924 | 88124 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 5 | 1345495 | 1345716 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 6 | 1121643 | 1121864 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 7 | 1316013 | 1316234 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 8 | 446247 | 446441 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 9 | 2018129 | 2018320 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 10 | 1723106 | 1723303 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 11 | 1758161 | 1758358 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 12 | 1411440 | 1411637 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 13 | 1323867 | 1324076 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 14 | 575850 | 576047 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 15 | 1894229 | 1894405 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 16 | 370778 | 370969 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 17 | 1789531 | 1789722 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 18 | 430164 | 430358 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 19 | 242257 | 242454 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 20 | 680094 | 680288 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 21 | 615129 | 615317 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 22 | 1055884 | 1056096 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 23 | 1983036 | 1983224 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 24 | 2132491 | 2132679 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 25 | 2078968 | 2079156 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 26 | 421990 | 422178 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 27 | 2327050 | 2327238 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 28 | 614068 | 614265 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 29 | 2009884 | 2010084 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 30 | 562723 | 562911 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 31 | 916624 | 916818 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 32 | 678002 | 678196 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 33 | 388766 | 388966 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 34 | 333615 | 333815 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 35 | 923699 | 923896 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 36 | 591229 | 591420 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 37 | 457448 | 457639 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 38 | 1928847 | 1929041 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 39 | 2726838 | 2727026 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 40 | 2323940 | 2324131 | - | NZ_LS974202.1 | Mesotoga infera |
| 41 | 694167 | 694361 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 42 | 690718 | 690903 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 43 | 1397278 | 1397463 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 44 | 2329441 | 2329632 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 45 | 521886 | 522074 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 46 | 315048 | 315236 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 47 | 4129354 | 4129536 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 48 | 2259177 | 2259371 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 49 | 1843116 | 1843313 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 50 | 1381880 | 1382068 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 51 | 766955 | 767143 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 52 | 922055 | 922249 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 53 | 1632310 | 1632498 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 54 | 656825 | 657016 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 55 | 1519730 | 1519921 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 56 | 1335333 | 1335524 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 57 | 2960011 | 2960202 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 58 | 3406436 | 3406627 | - | NZ_CP021434.1 | Tumebacillus avium |
| 59 | 1584701 | 1584889 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
++ More..