Result : O66478
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA 2 |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 41650 |
| Right | 41883 |
| Strand | + |
| Nucleotide Sequence | ATGTTTCCCGGCGGAATATCTATGACAGAGTTAATCATAATCCTTGCGGTTATCCTGCTACTCTTCGGTGCTGGAAGACTACCGGAAGCCGGAAGAGCGCTTGGTGAAGGTATAAGGAATTTCAGGAAGGCACTTTCAGGGGAGACGGAAGTAAAGGAAGTGAAGGCTGAAGACGTAAAGACGGAGGAGAGGAAAGAAGAAAAGAAGGAAGAGAAGGAAAAGGTAGAGGCTTAA |
| Sequence | MFPGGISMTELIIILAVILLLFGAGRLPEAGRALGEGIRNFRKALSGETEVKEVKAEDVKTEERKEEKKEEKEKVEA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 9537320 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | O66478 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 41650 | 41883 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 492434 | 492643 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 3 | 1579608 | 1579808 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 4 | 2062167 | 2062355 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 5 | 3242794 | 3242985 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 6 | 1639187 | 1639381 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 7 | 188008 | 188238 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
++ More..