Protein Information |
Information Type | Description |
---|---|
Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
NCBI Accession ID | AE000657.1 |
Organism | Aquifex aeolicus (strain VF5) |
Left | 30179 |
Right | 30478 |
Strand | + |
Nucleotide Sequence | ATGGTTAGGAAGCTGAGCGAAGAAGAAGTAAAGAGGGAACTTGAAAATCTGGAAGGCTGGGAATTCTGTAAAGATTACATACAGAAGGAGTTTTCCACAAAGAACTGGAAGACCACCATATTCGTGGTGAACGCCATAGCCTCTCTGGCGGAAGCCCAGTGGCACCACCCAGATTTAGAAGTCAGCTTTAAAAAGGTAAAGGTTAAACTCACCACTCACGAAGCTGGCGGGATAACGGAAAGAGATATTAAATTAGCAAAATCCATAGACGAGTTGGTGAAAGAAATACTAAAGCATTGA |
Sequence | MVRKLSEEEVKRELENLEGWEFCKDYIQKEFSTKNWKTTIFVVNAIASLAEAQWHHPDLEVSFKKVKVKLTTHEAGGITERDIKLAKSIDELVKEILKH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
Pubmed ID | 9537320 |
Domain | CDD:412663 |
Functional Category | Others |
Uniprot ID | O66462 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 30179 | 30478 | + | NC_000918.1 | Aquifex aeolicus VF5 |
2 | 1313212 | 1313526 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
3 | 1063632 | 1063907 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01475.21 | 0.67 | 2 | 0.0 | same-strand | Ferric uptake regulator family |