Result : O66462
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
| NCBI Accession ID | AE000657.1 |
| Organism | Aquifex aeolicus (strain VF5) |
| Left | 30179 |
| Right | 30478 |
| Strand | + |
| Nucleotide Sequence | ATGGTTAGGAAGCTGAGCGAAGAAGAAGTAAAGAGGGAACTTGAAAATCTGGAAGGCTGGGAATTCTGTAAAGATTACATACAGAAGGAGTTTTCCACAAAGAACTGGAAGACCACCATATTCGTGGTGAACGCCATAGCCTCTCTGGCGGAAGCCCAGTGGCACCACCCAGATTTAGAAGTCAGCTTTAAAAAGGTAAAGGTTAAACTCACCACTCACGAAGCTGGCGGGATAACGGAAAGAGATATTAAATTAGCAAAATCCATAGACGAGTTGGTGAAAGAAATACTAAAGCATTGA |
| Sequence | MVRKLSEEEVKRELENLEGWEFCKDYIQKEFSTKNWKTTIFVVNAIASLAEAQWHHPDLEVSFKKVKVKLTTHEAGGITERDIKLAKSIDELVKEILKH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
| Pubmed ID | 9537320 |
| Domain | CDD:412663 |
| Functional Category | Others |
| Uniprot ID | O66462 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 30179 | 30478 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 1313212 | 1313526 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 3 | 1063632 | 1063907 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017161.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01475.21 | 0.67 | 2 | 0.0 | same-strand | Ferric uptake regulator family |
++ More..