| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lantibiotic mutacin-2 (Lantibiotic mutacin H-29B) (Mutacin II) |
| NCBI Accession ID | U40620.1 |
| Organism | Streptococcus mutans |
| Left | 496 |
| Right | 657 |
| Strand | + |
| Nucleotide Sequence | ATGAACAAGTTAAACAGTAACGCAGTAGTTTCTTTGAATGAAGTTTCAGATTCTGAATTGGATACTATTTTGGGTGGTAATCGTTGGTGGCAAGGTGTTGTGCCAACGGTCTCATATGAGTGTCGCATGAATTCATGGCAACATGTTTTCACTTGCTGTTAA |
| Sequence | MNKLNSNAVVSLNEVSDSELDTILGGNRWWQGVVPTVSYECRMNSWQHVFTCC |
| Source of smORF | Swiss-Prot |
| Function | Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria including M.luteus, S.aureus, Streptococcus, P.micros, P.acidilactici, C.sporogenes, C.diphtheriae, A.viscosus, G.vaginalis, P.acnes, L.monocytogenes and M.smegmatis, and Gram-negative bacteria including C.jejuni, H.pylori and N.gonorrhoeae. Transiently and partially depolarizes the transmembrane electrical potential and pH gradient of susceptible cells, inhibits the uptake of amino acids and depletes the intracellular ATP pool. {ECO:0000269|Pubmed:16626493, ECO:0000269|Pubmed:8021218, ECO:0000269|Pubmed:8592997}. |
| Pubmed ID | 9461412 10821848 16626493 9647795 8021218 8592997 8660519 11179642 |
| Domain | CDD:368018 |
| Functional Category | Antimicrobial |
| Uniprot ID | O54329 |
| ORF Length (Amino Acid) | 53 |