Result : O53778
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB26 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 677710 |
| Right | 677925 |
| Strand | + |
| Nucleotide Sequence | GTGGACAAGACGACGGTCTACCTGCCGGATGAACTCAAGGCGGCCGTGAAGCGCGCCGCTCGGCAGCGCGGAGTCTCCGAAGCGCAGGTAATCCGGGAGTCCATCCGGGCGGCGGTCGGCGGCGCCAAGCCGCCGCCGCGCGGGGGTCTATATGCGGGTTCGGAGCCCATCGCGCGGCGAGTCGACGAGCTGCTGGCTGGCTTCGGTGAGCGGTGA |
| Sequence | MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPPPRGGLYAGSEPIARRVDELLAGFGER |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC26. {ECO:0000269|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 21969609 |
| Domain | CDD:419885 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O53778 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 677710 | 677925 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 692803 | 693018 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3799062 | 3799277 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 2113852 | 2114067 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 5 | 1232390 | 1232602 | - | NZ_CP033972.1 | Gordonia insulae |
| 6 | 483050 | 483262 | - | NZ_CP064760.1 | Microbacterium schleiferi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 6 | -3.0 | same-strand | PIN domain |
++ More..