Result : O53672
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv0250c |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 301735 |
| Right | 302028 |
| Strand | - |
| Nucleotide Sequence | TTGTCCACGACTGCCGAACTCGCCGAACTGCACGACCTCGTCGGCGGACTGCGGCGGTGCGTGACCGCACTGAAGGCGCGATTCGGCGACAACCCGGCAACGCGTCGCATCGTGATCGATGCCGACCGGATCCTCACCGACATCGAATTGCTCGACACCGACGTCTCTGAATTAGACCTGGAACGGGCCGCCGTACCGCAACCCAGCGAGAAAATCGCCATCCCCGACACCGAGTACGATCGCGAATTTTGGCGCGATGTCGACGATGAGGGTGTCGGAGGTCACAGGTACTGA |
| Sequence | MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRILTDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 17259624 21969609 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O53672 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 301735 | 302028 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 308494 | 308787 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3534611 | 3534907 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 450085 | 450381 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 5 | 3680559 | 3680855 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 6 | 4180683 | 4180979 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 7 | 640816 | 641112 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 8 | 4472039 | 4472275 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 9 | 470934 | 471230 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 10 | 4673567 | 4673803 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 11 | 1684906 | 1685202 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 12 | 3183869 | 3184165 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 13 | 2168166 | 2168462 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 14 | 681411 | 681707 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 15 | 2038944 | 2039240 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 16 | 4059065 | 4059361 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 17 | 1825447 | 1825743 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 18 | 2147910 | 2148206 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 19 | 3795385 | 3795621 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 20 | 4887132 | 4887368 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 21 | 5042993 | 5043229 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 22 | 5145058 | 5145294 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 23 | 4840731 | 4840967 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 24 | 74686 | 74922 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 25 | 336358 | 336654 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 26 | 3493144 | 3493440 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 27 | 1152803 | 1153099 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 28 | 3958948 | 3959184 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 29 | 2971546 | 2971842 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 30 | 1064733 | 1065032 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 31 | 4627120 | 4627419 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 32 | 1882832 | 1883128 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 33 | 235984 | 236280 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 34 | 1709337 | 1709633 | + | NZ_AP022562.1 | Mycobacterium novum |
| 35 | 248245 | 248541 | - | NC_015576.1 | Mycolicibacter sinensis |
| 36 | 5452496 | 5452792 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 37 | 4555121 | 4555420 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 38 | 3450879 | 3451175 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 39 | 2100214 | 2100510 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 40 | 1976794 | 1977090 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 41 | 4618549 | 4618845 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 42 | 4623722 | 4624018 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 43 | 4873626 | 4873928 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 44 | 4800301 | 4800597 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 45 | 175125 | 175418 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 46 | 4220845 | 4221141 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 47 | 876087 | 876383 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 48 | 1829038 | 1829328 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 49 | 303017 | 303253 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 50 | 323972 | 324208 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 51 | 3184341 | 3184637 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 52 | 607423 | 607659 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 53 | 4609715 | 4610011 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 54 | 107540 | 107836 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 55 | 4088945 | 4089241 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 56 | 1690365 | 1690664 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 57 | 374232 | 374528 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 58 | 1077743 | 1077991 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 59 | 1690305 | 1690601 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 60 | 3329912 | 3330208 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 61 | 7124865 | 7125155 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 62 | 310728 | 311030 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 63 | 600504 | 600800 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 64 | 3842723 | 3843013 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 65 | 1688010 | 1688315 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 66 | 474450 | 474746 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 67 | 1936507 | 1936803 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 68 | 2064801 | 2065097 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 69 | 918161 | 918451 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 70 | 332462 | 332746 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 71 | 3430789 | 3431076 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 72 | 4326013 | 4326285 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 73 | 4550327 | 4550599 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 74 | 4546144 | 4546416 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 75 | 4193475 | 4193747 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 76 | 5043409 | 5043681 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 77 | 4506216 | 4506488 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 78 | 298302 | 298550 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 79 | 2546483 | 2546776 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 80 | 3857107 | 3857346 | - | NZ_AP022569.1 | Mycobacterium cookii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP025546.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01613.20 | 0.66 | 53 | 3904 | opposite-strand | Flavin reductase like domain |
| 2 | PF13085.8 | 0.99 | 79 | 2869 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 3 | PF13183.8 | 0.99 | 79 | 2869 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF00111.29 | 0.99 | 79 | 2869 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 5 | PF13534.8 | 0.89 | 71 | 2870 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF00890.26 | 0.99 | 79 | 944 | same-strand | FAD binding domain |
| 7 | PF07992.16 | 0.64 | 51 | 1612 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 8 | PF01077.24 | 0.66 | 53 | 1577 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 9 | PF00070.29 | 0.7 | 56 | 1615.0 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 10 | PF04324.17 | 0.7 | 56 | 1615.0 | opposite-strand | BFD-like [2Fe-2S] binding domain |
| 11 | PF03460.19 | 0.69 | 55 | 1612 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 12 | PF18267.3 | 0.7 | 56 | 1615.0 | opposite-strand | Rubredoxin NAD+ reductase C-terminal domain |
| 13 | PF13806.8 | 0.6 | 48 | 4015.0 | opposite-strand | Rieske-like [2Fe-2S] domain |
| 14 | PF13714.8 | 0.61 | 49 | 118 | opposite-strand | Phosphoenolpyruvate phosphomutase |
++ More..