ProsmORF-pred
Result : O51726
Protein Information
Information Type Description
Protein name Putative septation protein SpoVG
NCBI Accession ID AE000783.1
Organism Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Left 822810
Right 823103
Strand +
Nucleotide Sequence GTGGATATTACAGACATAAGGATTAAGAAAGTTGATAGTAAAAATTCTGGTTCTAAATTATTAGCATATGTTGCAGTTACTTTTGATAACTGTTTGGTTCTTCACAATATTAGAGTTATTAAAGGGCAAAAGGGAGTATTTATTGCGATGCCTAACAGAAGAACTAGAGTCGGTGAATATAAAGACATTGTACATCCTATTAGTCAGGATTTTAGAAAAGCTTTGCAAACTTCTATTTTTAAGGAATATATAAGAGAAAATCCAGCCGATCTTGAACTTGAATTAGATTTTTAG
Sequence MDITDIRIKKVDSKNSGSKLLAYVAVTFDNCLVLHNIRVIKGQKGVFIAMPNRRTRVGEYKDIVHPISQDFRKALQTSIFKEYIRENPADLELELDF
Source of smORF Swiss-Prot
Function Could be involved in septation. {ECO:0000255|HAMAP-Rule:MF_00819}.
Pubmed ID 9403685
Domain CDD:412646
Functional Category Others
Uniprot ID O51726
ORF Length (Amino Acid) 97
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 72
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 820355 820648 + NC_015921.1 Borreliella bissettii DN127
2 820499 820792 + NZ_CP044535.1 Borrelia maritima
3 823717 824010 + NZ_CP015796.1 Borreliella mayonii
4 825618 825911 + NZ_CP028861.1 Borreliella garinii
5 851147 851437 + NZ_CP028884.1 Borrelia turcica IST7
6 82723 83013 - NZ_CP024333.1 Borrelia miyamotoi
7 834404 834694 + NZ_CP011060.1 Borrelia hermsii CC1
8 844858 845148 + NC_011244.1 Borrelia recurrentis A1
9 820857 821147 + NZ_CP013704.1 Borrelia anserina Es
10 830583 830873 + NZ_CP007022.1 Borrelia parkeri HR1
11 830734 831024 + NC_008710.1 Borrelia turicatae 91E135
12 2099663 2099941 + NZ_CP031518.1 Treponema ruminis
13 1958330 1958608 - NC_015385.1 Treponema succinifaciens DSM 2489
14 1198525 1198827 + NC_017583.1 Spirochaeta thermophila DSM 6578
15 2685432 2685713 - NC_015577.1 Treponema azotonutricium ZAS-9
16 1534541 1534825 + NC_023035.1 Salinispira pacifica
17 2147145 2147444 - NC_017098.1 Spirochaeta africana DSM 8902
18 3110726 3111007 + NC_015578.1 Treponema primitia ZAS-2
19 1728060 1728347 - NZ_CP054142.1 Treponema parvum
20 870308 870589 + NC_015732.1 Treponema caldarium DSM 7334
21 3561041 3561319 + NZ_CP035807.1 Thiospirochaeta perfilievii
22 1128044 1128334 - NC_015436.1 Sphaerochaeta coccoides DSM 17374
23 1548111 1548398 - NZ_CP036150.1 Oceanispirochaeta crateris
24 1585245 1585499 + NC_022097.1 Treponema pedis str. T A4
25 2209600 2209878 - NZ_CP009170.1 Thermoanaerobacter kivui
26 174146 174424 + NC_014964.1 Thermoanaerobacter brockii subsp. finnii Ako-1
27 2617192 2617470 - NC_015958.1 Thermoanaerobacter wiegelii Rt8.B1
28 2170009 2170287 - NC_014209.1 Thermoanaerobacter mathranii subsp. mathranii str. A3
29 2287459 2287737 - NC_013921.1 Thermoanaerobacter italicus Ab9
30 2093829 2094119 - NC_015500.1 Treponema brennaborense DSM 12168
31 188287 188568 + NC_014410.1 Thermoanaerobacterium thermosaccharolyticum DSM 571
32 1448140 1448427 - NZ_CP029256.1 Christensenella minuta
33 2463420 2463695 - NC_003869.1 Caldanaerobacter subterraneus subsp. tengcongensis MB4
34 4591589 4591867 - NC_014393.1 Clostridium cellulovorans 743B
35 3763771 3764058 - NZ_CP028842.1 Clostridium botulinum
36 4044792 4045079 - NZ_CP011663.1 Clostridium sporogenes
37 2273415 2273681 - NC_014657.1 Caldicellulosiruptor owensensis OL
38 2332127 2332393 - NC_014392.1 Caldicellulosiruptor obsidiansis OB47
39 353983 354249 + NZ_CP034791.1 Caldicellulosiruptor changbaiensis
40 367156 367422 + NC_009437.1 Caldicellulosiruptor saccharolyticus DSM 8903
41 3287045 3287329 + NC_016633.1 Sphaerochaeta pleomorpha str. Grapes
42 2752391 2752678 - NZ_HG917868.1 Clostridium bornimense
43 361870 362136 + NC_015949.1 Caldicellulosiruptor lactoaceticus 6A
44 2632500 2632766 - NC_014652.1 Caldicellulosiruptor hydrothermalis 108
45 2130324 2130590 - NC_014721.1 Caldicellulosiruptor kristjanssonii I77R1B
46 2689403 2689669 - NC_014720.1 Caldicellulosiruptor kronotskyensis 2002
47 2550878 2551144 - NC_012034.1 Caldicellulosiruptor bescii DSM 6725
48 126929 127204 + NC_022571.1 Clostridium saccharobutylicum DSM 13864
49 3374577 3374864 - NC_015687.1 Clostridium acetobutylicum DSM 1731
50 3625658 3625933 - NZ_CP030775.1 Clostridium butyricum
51 1043707 1043997 + NZ_CP028103.1 Fusobacterium varium ATCC 27725
52 4013428 4013715 - NZ_CP013019.1 Clostridium pasteurianum
53 148197 148472 + NZ_CP017253.2 Clostridium taeniosporum
54 2724860 2725150 - NZ_CP032416.1 Clostridium fermenticellae
55 112221 112496 + NC_020291.1 Clostridium saccharoperbutylacetonicum N1-4(HMT)
56 3075372 3075644 - NC_008261.1 Clostridium perfringens ATCC 13124
57 102620 102895 + NZ_CP043998.1 Clostridium diolis
58 3630706 3630957 - NC_011898.1 Ruminiclostridium cellulolyticum H10
59 2113594 2113878 - NC_015152.1 Sphaerochaeta globosa str. Buddy
60 236915 237199 + NZ_CP016502.1 Acetivibrio thermocellus DSM 2360
61 5372717 5373007 - NZ_CP020953.1 Clostridium drakei
62 4516057 4516347 - NZ_CP011803.1 Clostridium carboxidivorans P7
63 4551455 4551745 + NZ_CP009933.1 Clostridium scatologenes
64 1067796 1068068 - NZ_CP071376.1 Clostridium gasigenes
65 1919751 1919987 + NZ_CP023671.1 Clostridium septicum
66 135810 136100 + NC_011837.1 Clostridium kluyveri NBRC 12016
67 155185 155421 + NZ_CP027286.1 Clostridium chauvoei
68 2962234 2962521 - NZ_CP014170.1 Clostridium tyrobutyricum
69 2154012 2154302 - NZ_CP012395.1 Clostridium autoethanogenum DSM 10061
70 4521242 4521532 - NC_014328.1 Clostridium ljungdahlii DSM 13528
71 63412 63675 + NZ_CP021850.1 Pseudoclostridium thermosuccinogenes
72 540453 540740 + NZ_CP014176.1 Clostridium argentinense
++ More..