Result : O51647
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein (ACP) |
| NCBI Accession ID | AE000783.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 740446 |
| Right | 740688 |
| Strand | + |
| Nucleotide Sequence | ATGGATAATGATGAAATTTTTAGCAAGGTTAGGTCTATTATATCTGAGCAACTTGATAAAAAAGAAGATGAAATTACCACAGACTCTAGATTTGTTGAAGATCTTAATGCAGATAGTCTAGATATTTATGAGCTTTTGTATTTGCTTGAAGAGGCCTTTGATGATAAGATTCCAGAGAATGAAGCCAATGAATTTGAGACGGTAGGCGATGTTGTTAATTTTATTAAAAAGAGAAAGGGTTGA |
| Sequence | MDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01217}. |
| Pubmed ID | 9403685 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | O51647 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 112
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 737997 | 738239 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 741279 | 741521 | + | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 743330 | 743572 | + | NZ_CP028861.1 | Borreliella garinii |
| 4 | 738144 | 738386 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 747756 | 747998 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 6 | 759282 | 759524 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 7 | 735025 | 735267 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 8 | 745000 | 745242 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 9 | 169348 | 169590 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 10 | 765626 | 765868 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 11 | 744825 | 745067 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 12 | 1947760 | 1948002 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 13 | 1520912 | 1521136 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 14 | 1594589 | 1594828 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 15 | 2721515 | 2721739 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 16 | 1222090 | 1222311 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 17 | 1268203 | 1268433 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 18 | 196582 | 196812 | - | NZ_CP023671.1 | Clostridium septicum |
| 19 | 1044664 | 1044912 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 20 | 3267175 | 3267402 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 21 | 1416547 | 1416786 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 22 | 1815974 | 1816207 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 23 | 2281161 | 2281394 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 24 | 1320224 | 1320451 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 25 | 1057442 | 1057678 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 26 | 1933713 | 1933940 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 27 | 2798633 | 2798866 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 28 | 128489 | 128725 | - | NZ_CP009228.1 | Treponema putidum |
| 29 | 1719201 | 1719440 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 30 | 3104160 | 3104390 | - | NZ_CP014176.1 | Clostridium argentinense |
| 31 | 971667 | 971879 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 32 | 1294396 | 1294656 | - | NZ_LR699119.1 | Aquicella siphonis |
| 33 | 1328300 | 1328527 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 34 | 1306501 | 1306728 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 35 | 3616625 | 3616858 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 36 | 1380569 | 1380802 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 37 | 1964459 | 1964683 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 38 | 3692020 | 3692247 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 39 | 1212617 | 1212877 | - | NZ_LR699114.1 | Aquicella lusitana |
| 40 | 3536544 | 3536777 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 41 | 872520 | 872723 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 42 | 2534404 | 2534640 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 43 | 1443892 | 1444107 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 44 | 2536263 | 2536496 | - | NZ_CP028842.1 | Clostridium botulinum |
| 45 | 1594529 | 1594744 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 46 | 6709036 | 6709230 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 47 | 4894310 | 4894537 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 48 | 1318148 | 1318375 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 49 | 1429967 | 1430194 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 50 | 1763977 | 1764213 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 51 | 2220476 | 2220706 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 52 | 2576263 | 2576490 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 53 | 3810475 | 3810684 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 54 | 552371 | 552604 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 55 | 1184156 | 1184389 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 56 | 1759709 | 1759906 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 57 | 3270290 | 3270484 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 58 | 1178011 | 1178238 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 59 | 2506490 | 2506726 | - | NZ_CP038853.1 | Pantoea vagans |
| 60 | 4430962 | 4431198 | + | NZ_CP049115.1 | Pantoea stewartii |
| 61 | 1495910 | 1496143 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 62 | 1416164 | 1416394 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 63 | 1493061 | 1493291 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 64 | 1493347 | 1493577 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 65 | 2882470 | 2882706 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 66 | 547310 | 547537 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 67 | 1896109 | 1896342 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 68 | 2593271 | 2593507 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 69 | 2717318 | 2717512 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 70 | 1689834 | 1690061 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 71 | 1527148 | 1527384 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 72 | 3899633 | 3899842 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 73 | 1058919 | 1059161 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 74 | 4056632 | 4056826 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 75 | 1264444 | 1264674 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 76 | 896308 | 896538 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 77 | 551991 | 552227 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 78 | 1433783 | 1433977 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 79 | 611728 | 611964 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 80 | 972510 | 972749 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 81 | 3244502 | 3244717 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 82 | 1449101 | 1449340 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 83 | 4717272 | 4717511 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 84 | 1184724 | 1184963 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 85 | 1197184 | 1197423 | + | NZ_CP010975.1 | Kangiella geojedonensis |
| 86 | 801672 | 801911 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 87 | 790122 | 790325 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 88 | 932507 | 932746 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 89 | 522423 | 522662 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 90 | 101980 | 102219 | + | NC_016893.1 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony) |
| 91 | 2736204 | 2736437 | - | NZ_CP007445.1 | Gilliamella apicola |
| 92 | 3451051 | 3451287 | + | NZ_CP065640.1 | Serratia rubidaea |
| 93 | 239278 | 239511 | + | NZ_CP009056.1 | Frischella perrara |
| 94 | 1014063 | 1014299 | - | NZ_CP009787.1 | Yersinia rohdei |
| 95 | 920858 | 921094 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 96 | 3881427 | 3881663 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 97 | 1747080 | 1747316 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 98 | 1931671 | 1931907 | + | NZ_CP043727.1 | Yersinia canariae |
| 99 | 1907219 | 1907455 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 100 | 1395233 | 1395469 | + | NZ_CP032487.1 | Yersinia hibernica |
| 101 | 4525411 | 4525647 | - | NZ_CP007230.1 | Yersinia similis |
| 102 | 2643480 | 2643716 | - | NZ_CP046293.1 | Yersinia intermedia |
| 103 | 1636947 | 1637180 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 104 | 1177512 | 1177745 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 105 | 331038 | 331277 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 106 | 1785066 | 1785299 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 107 | 1297406 | 1297639 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 108 | 2985932 | 2986162 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 109 | 2030381 | 2030617 | - | NZ_LS483470.1 | Leminorella richardii |
| 110 | 3736325 | 3736558 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 111 | 1895450 | 1895686 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 112 | 2533770 | 2534000 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14622.8 | 0.63 | 71 | 176 | same-strand | Ribonuclease-III-like |
| 2 | PF00636.28 | 0.63 | 71 | 176 | same-strand | Ribonuclease III domain |
| 3 | PF00035.28 | 0.63 | 71 | 176 | same-strand | Double-stranded RNA binding motif |
| 4 | PF13561.8 | 0.67 | 75 | 112 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 5 | PF00106.27 | 0.67 | 75 | 112 | same-strand | short chain dehydrogenase |
| 6 | PF08659.12 | 0.67 | 75 | 112 | same-strand | KR domain |
| 7 | PF00698.23 | 0.62 | 69 | 873 | same-strand | Acyl transferase domain |
| 8 | PF02504.17 | 0.71 | 79 | 2828 | same-strand | Fatty acid synthesis protein |
++ More..