Result : O51646

Protein Information

• Protein name: 50S ribosomal protein L32
• NCBI Accession ID: AE000783.1
• Organism: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
• Left: 740240
• Right: 740422
• Strand: +
• Nucleotide Sequence: ATGGCTGTTCCAAAATTTAAGCCTTCAAAATCTAGAAGTAGAACAAGGCGGAGTATAAATATGAGAAAAAAAATTCCACAATTTCAAGAATGTTCTAATTGTGGTAATCTTGGCGTGAGACATAGGATTTGTTTAAAATGTGGATATTATAGGAATAACCAATATCTAGAAATAGGTTTGTAG
• Sequence: MAVPKFKPSKSRSRTRRSINMRKKIPQFQECSNCGNLGVRHRICLKCGYYRNNQYLEIGL
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification]
• Pubmed ID: 9403685
• Domain: CDD:415589
• Functional Category: Ribosomal_protein
• Uniprot ID: O51646
• ORF Length (Amino Acid): 60

Conservation Analysis

No. of Species: 33

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	743124	743306	+	NZ_CP028861.1	Borreliella garinii
2	737937	738119	+	NZ_CP044535.1	Borrelia maritima
3	741073	741255	+	NZ_CP015796.1	Borreliella mayonii
4	737791	737973	+	NC_015921.1	Borreliella bissettii DN127
5	765421	765603	+	NZ_CP028884.1	Borrelia turcica IST7
6	744620	744802	+	NZ_CP007022.1	Borrelia parkeri HR1
7	744795	744977	+	NC_008710.1	Borrelia turicatae 91E135
8	759077	759259	+	NC_011244.1	Borrelia recurrentis A1
9	169613	169789	-	NZ_CP024333.1	Borrelia miyamotoi
10	747551	747733	+	NZ_CP011060.1	Borrelia hermsii CC1
11	734820	735002	+	NZ_CP013704.1	Borrelia anserina Es
12	1296318	1296506	+	NZ_CP036150.1	Oceanispirochaeta crateris
13	3136957	3137145	+	NZ_CP035807.1	Thiospirochaeta perfilievii
14	1672606	1672791	-	NC_015500.1	Treponema brennaborense DSM 12168
15	2856520	2856708	-	NC_015577.1	Treponema azotonutricium ZAS-9
16	1594787	1594975	-	NC_015732.1	Treponema caldarium DSM 7334
17	1264498	1264686	+	NZ_CP054142.1	Treponema parvum
18	1200984	1201172	+	NZ_CP031518.1	Treponema ruminis
19	872238	872426	+	NC_015714.1	Treponema paraluiscuniculi Cuniculi A
20	2417201	2417389	+	NC_022097.1	Treponema pedis str. T A4
21	128739	128927	-	NZ_CP009228.1	Treponema putidum
22	1057241	1057429	+	NC_002967.9	Treponema denticola ATCC 35405
23	1489658	1489846	+	NC_015578.1	Treponema primitia ZAS-2
24	35570	35767	+	NZ_CP030356.1	Salinibacter ruber
25	2039994	2040182	+	NC_014364.1	Sediminispirochaeta smaragdinae DSM 11293
26	913872	914054	+	NZ_CP011232.1	Kosmotoga pacifica
27	1221850	1222038	+	NC_017583.1	Spirochaeta thermophila DSM 6578
28	4376911	4377090	+	NZ_CP010836.1	Sphingomonas hengshuiensis
29	2544446	2544625	-	NZ_CP060717.1	Sphingomonas rhizophila
30	1466178	1466357	-	NZ_CP017641.1	Fuerstia marisgermanicae
31	72063	72242	+	NZ_CP060782.1	Sphingomonas sediminicola
32	3020453	3020635	-	NZ_CP042582.1	Hypericibacter adhaerens
33	3399830	3400015	+	NZ_CP041636.1	Ferrovibrio terrae

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP028861.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00550.27	0.76	25	23	same-strand	Phosphopantetheine attachment site
2	PF14622.8	0.76	25	271	same-strand	Ribonuclease-III-like
3	PF00636.28	0.76	25	271	same-strand	Ribonuclease III domain
4	PF00035.28	0.76	25	271	same-strand	Double-stranded RNA binding motif