Result : O51356
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | AE000783.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 407922 |
| Right | 408092 |
| Strand | - |
| Nucleotide Sequence | GTGTTTAGGTTTATCAAAGATAGTATCTTAGAGCTTAAGAAGGTAACGTGGCCTAAGTATAATGAAGTTGTTGGAAATGGAAAGCAAGTTTTTTGGCTGGTATTATTTGTTTCAATTTTCTTGGGTATAGTCGATTATCTTATGTTTCTTGTTGTAACTTATGTATTTTAG |
| Sequence | MFRFIKDSILELKKVTWPKYNEVVGNGKQVFWLVLFVSIFLGIVDYLMFLVVTYVF |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 9403685 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | O51356 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 406414 | 406584 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 408700 | 408870 | - | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 406519 | 406689 | - | NZ_CP044535.1 | Borrelia maritima |
| 4 | 409310 | 409480 | - | NZ_CP028861.1 | Borreliella garinii |
| 5 | 408121 | 408291 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 6 | 408242 | 408412 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 7 | 428284 | 428454 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 8 | 499703 | 499873 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 9 | 409571 | 409741 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 10 | 420241 | 420411 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 11 | 401442 | 401612 | - | NZ_CP013704.1 | Borrelia anserina Es |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007022.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00542.21 | 1.0 | 11 | 2305 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 2 | PF16320.7 | 1.0 | 11 | 2305 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
| 3 | PF00466.22 | 1.0 | 11 | 1743 | same-strand | Ribosomal protein L10 |
| 4 | PF00687.23 | 1.0 | 11 | 1060 | same-strand | Ribosomal protein L1p/L10e family |
| 5 | PF00298.21 | 1.0 | 11 | 621 | same-strand | Ribosomal protein L11, RNA binding domain |
| 6 | PF03946.16 | 1.0 | 11 | 621 | same-strand | Ribosomal protein L11, N-terminal domain |
| 7 | PF02357.21 | 1.0 | 11 | 10 | same-strand | Transcription termination factor nusG |
| 8 | PF00471.22 | 1.0 | 11 | 113 | same-strand | Ribosomal protein L33 |
| 9 | PF13637.8 | 0.73 | 8 | 3745.0 | opposite-strand | Ankyrin repeats (many copies) |
| 10 | PF08239.13 | 0.64 | 7 | 2434 | opposite-strand | Bacterial SH3 domain |
++ More..