Result : O51340
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative phosphotransferase enzyme IIB component BB_0367 (EC 2.7.1.-) (Putative PTS system EIIB component) |
| NCBI Accession ID | AE000783.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 375661 |
| Right | 375939 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGATTTAGAAAAAATAAATAAAATTAAAGTAGCAGAGCATATTGTAGAATGCTTCGGGGGAATTAAAAATATTAAAAACATAGACAAAGACCTAACAAGAATAAAAATTTTAGTAGACAGCAATTCTTTAGTCAAAAGAGACGATTTAACAAAAAATGACAACATAATAGGAACTATTAAATCTAATGAACTTACAGAAGTTGTAATAAATTTTGAAATAATCGAGGATGTTTATAATAAAATTTTATATATGATGAATGAGCAAAAACAATAA |
| Sequence | MADLEKINKIKVAEHIVECFGGIKNIKNIDKDLTRIKILVDSNSLVKRDDLTKNDNIIGTIKSNELTEVVINFEIIEDVYNKILYMMNEQKQ |
| Source of smORF | Swiss-Prot |
| Function | The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. {ECO:0000250}. |
| Pubmed ID | 9403685 |
| Domain | CDD:421868 |
| Functional Category | Others |
| Uniprot ID | O51340 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 376459 | 376737 | + | NZ_CP015796.1 | Borreliella mayonii |
| 2 | 374127 | 374405 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 3 | 375160 | 375438 | + | NZ_CP028861.1 | Borreliella garinii |
| 4 | 374271 | 374552 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 388063 | 388329 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 6 | 376463 | 376729 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 7 | 376579 | 376845 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 8 | 377923 | 378186 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 9 | 396639 | 396902 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 10 | 370366 | 370629 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 11 | 530365 | 530631 | - | NZ_CP024333.1 | Borrelia miyamotoi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007022.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01790.20 | 0.91 | 10 | 3636.5 | same-strand | Prolipoprotein diacylglyceryl transferase |
| 2 | PF00563.22 | 1.0 | 11 | 1592 | same-strand | EAL domain |
| 3 | PF02127.17 | 1.0 | 11 | 6 | same-strand | Aminopeptidase I zinc metalloprotease (M18) |
| 4 | PF01210.25 | 1.0 | 11 | 21 | opposite-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
| 5 | PF07479.16 | 1.0 | 11 | 21 | opposite-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
| 6 | PF00004.31 | 1.0 | 11 | 1096 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF13401.8 | 0.64 | 7 | 1098 | opposite-strand | AAA domain |
| 8 | PF00579.27 | 1.0 | 11 | 3397 | opposite-strand | tRNA synthetases class I (W and Y) |
| 9 | PF03129.22 | 1.0 | 11 | 4614 | opposite-strand | Anticodon binding domain |
| 10 | PF00749.23 | 0.91 | 10 | 5973.0 | opposite-strand | tRNA synthetases class I (E and Q), catalytic domain |
| 11 | PF19269.1 | 0.91 | 10 | 5973.0 | opposite-strand | Anticodon binding domain |
| 12 | PF13614.8 | 0.64 | 7 | 4567 | same-strand | AAA domain |
| 13 | PF01656.25 | 0.64 | 7 | 4567 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..