Result : O51168
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AE000783.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 144307 |
| Right | 144597 |
| Strand | + |
| Nucleotide Sequence | ATGAACATTTTTAAAATTTTATTTATCTTAAATTATGCTCTTATTTTTCTAATAAAAATTTACCAAAATACTTTATCTAAAATATTTGGACTACAATGCATATACAAACCTACCTGCTCAAAATATTCAATTGAATGTCTTAAAAAATACAATTTTTTAACGGCTTTAATATTAATGACACTAAGAATAATAAGATGTAACGCATTATTCAAAGGGGGAAACGATTTTACTCCTAAATACAAACCCATTTTAGAATCCTTAAAAGAATTTAAAAAAAGATTAATCAAATAA |
| Sequence | MNIFKILFILNYALIFLIKIYQNTLSKIFGLQCIYKPTCSKYSIECLKKYNFLTALILMTLRIIRCNALFKGGNDFTPKYKPILESLKEFKKRLIK |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 9403685 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | O51168 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 143835 | 144125 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 145359 | 145649 | + | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 144007 | 144297 | + | NZ_CP028861.1 | Borreliella garinii |
| 4 | 143397 | 143687 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 143247 | 143489 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 6 | 144654 | 144947 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 7 | 147896 | 148189 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 8 | 144368 | 144625 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 9 | 144292 | 144549 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 10 | 761853 | 762146 | - | NZ_CP024333.1 | Borrelia miyamotoi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015921.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 0.9 | 9 | 6164 | opposite-strand | AMP-binding enzyme |
| 2 | PF00873.21 | 1.0 | 10 | 2361.0 | opposite-strand | AcrB/AcrD/AcrF family |
| 3 | PF13437.8 | 0.9 | 9 | 1382 | opposite-strand | HlyD family secretion protein |
| 4 | PF02321.20 | 1.0 | 10 | 123.0 | opposite-strand | Outer membrane efflux protein |
| 5 | PF04069.14 | 1.0 | 10 | -11.0 | opposite-strand | Substrate binding domain of ABC-type glycine betaine transport system |
| 6 | PF00528.24 | 1.0 | 10 | 922.0 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 7 | PF00005.29 | 1.0 | 10 | 1828.0 | opposite-strand | ABC transporter |
| 8 | PF00669.22 | 1.0 | 10 | 3076.0 | opposite-strand | Bacterial flagellin N-terminal helical region |
| 9 | PF00700.23 | 1.0 | 10 | 3076.0 | opposite-strand | Bacterial flagellin C-terminal helical region |
| 10 | PF00460.22 | 1.0 | 10 | 3076.0 | opposite-strand | Flagella basal body rod protein |
++ More..