Result : A3DE86
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000568.1 |
| Organism | Hungateiclostridium thermocellum (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Clostridium thermocellum) |
| Left | 1236104 |
| Right | 1236391 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGTTGACAAAGAAACAATAGAATATGTTGCAAATCTTGCACGATTAAGGCTTTCCGAAAAAGAAAAGGAAAAGCTTGCTTTAGACCTGGAAAGTATTATATCCTATGTGGATAAATTAAATGAACTTGATACGTCAAAAATTATTCCAACAGATCATGTCATACCTATAAAAAATGTTTTCCGAGACGATGAGGTCCGAGATTCATATCCAAAAGACAAAATGCTCATGAATGCTCCGGAAAAAGAGGACGGATGTTTTAAAGTGCCCAAAGTGGTTGAATAG |
| Sequence | MKVDKETIEYVANLARLRLSEKEKEKLALDLESIISYVDKLNELDTSKIIPTDHVIPIKNVFRDDEVRDSYPKDKMLMNAPEKEDGCFKVPKVVE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A3DE86 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 69
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1407547 | 1407834 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 2 | 2911633 | 2911920 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 3 | 657776 | 658066 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 4 | 609738 | 610025 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 5 | 684710 | 684997 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 6 | 642064 | 642351 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 7 | 1721936 | 1722223 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 8 | 584357 | 584644 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 9 | 719434 | 719721 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 10 | 3456538 | 3456825 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 11 | 204337 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 12 | 697205 | 697492 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 13 | 2301599 | 2301892 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 14 | 5188740 | 5189027 | - | NZ_AP019400.1 | Cohnella abietis |
| 15 | 455926 | 456213 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 16 | 23236 | 23517 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 17 | 2527914 | 2528201 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 18 | 3152366 | 3152653 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 19 | 1630525 | 1630812 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 20 | 917521 | 917808 | + | NC_014624.2 | Eubacterium callanderi |
| 21 | 3771030 | 3771317 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 22 | 2645723 | 2646010 | + | NZ_CP019962.1 | Eubacterium limosum |
| 23 | 774216 | 774503 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 24 | 2084303 | 2084590 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 25 | 1385287 | 1385574 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 26 | 3718972 | 3719259 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 27 | 2153510 | 2153806 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 28 | 3218352 | 3218636 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 29 | 2123143 | 2123376 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 30 | 4795478 | 4795765 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 31 | 805613 | 805897 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 32 | 2552901 | 2553188 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 33 | 551541 | 551828 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 34 | 699842 | 700126 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 35 | 1427247 | 1427531 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 36 | 850185 | 850418 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 37 | 93142 | 93429 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 38 | 2019174 | 2019458 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 39 | 1675772 | 1676059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 40 | 2552901 | 2553194 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 41 | 5693287 | 5693574 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 42 | 1024580 | 1024864 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 43 | 3047483 | 3047770 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 44 | 1963934 | 1964167 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 45 | 473113 | 473370 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 46 | 389836 | 390126 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 47 | 2060078 | 2060311 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 48 | 1080145 | 1080393 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 49 | 4964716 | 4965003 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 50 | 450751 | 451038 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 51 | 515752 | 516039 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 52 | 569306 | 569596 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 53 | 2347617 | 2347868 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 54 | 5726803 | 5727060 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 55 | 4763584 | 4763877 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 56 | 6801367 | 6801654 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 57 | 716158 | 716445 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 58 | 5493326 | 5493565 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 59 | 1059483 | 1059770 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 60 | 2037720 | 2037962 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 61 | 2103001 | 2103285 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 62 | 576249 | 576539 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 63 | 5168194 | 5168433 | - | NZ_CP026363.1 | Brevibacillus agri |
| 64 | 4011951 | 4012241 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 65 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 66 | 833453 | 833731 | - | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 67 | 2347892 | 2348179 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 68 | 2558039 | 2558332 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 69 | 4048322 | 4048570 | - | NZ_CP022437.1 | Virgibacillus necropolis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 1.0 | 69 | 30 | same-strand | Amidase |
| 2 | PF02934.17 | 0.97 | 67 | 1510 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.97 | 67 | 1510 | same-strand | GatB domain |
++ More..