Result : O51025
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein BBF20 |
| NCBI Accession ID | |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNKKFSISLLSTILAFLLVLGCDLSSNNAENKMDDIFNLEKKYMDNSNYKCLSKNEAIVKNSKIKLGVNNTRSRSYSSRETNVSDSYNKTYSYCKSN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17472. Profile Description: Family of unknown function (DUF5425). This is a family of unknown function found in Borreliella burgdorferi. |
| Pubmed ID | 9403685 |
| Domain | CDD:340187 |
| Functional Category | Others |
| Uniprot ID | O51025 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 7553 | 7846 | - | NC_015918.1 | Borreliella bissettii DN127 |
| 2 | 15919 | 16212 | - | NZ_CP015803.1 | Borreliella mayonii |
| 3 | 27251 | 27544 | - | NZ_CP028863.1 | Borreliella garinii |
| 4 | 10860 | 11153 | - | NZ_CP044540.1 | Borrelia maritima |
| 5 | 17900 | 18193 | - | NC_015915.1 | Borreliella bissettii DN127 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015803.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02414.17 | 0.75 | 3 | 178 | opposite-strand | Borrelia ORF-A |
++ More..