Result : O50515
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphocarrier protein HPr (Histidine-containing protein) |
| NCBI Accession ID | AL939125.1 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Left | 105045 |
| Right | 105326 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGAGCGCCGCGTCAACGTCGGCTGGGCCGAGGGTCTCCACGCCCGCCCCGCCTCCATCTTCGTCCGAGCCGCCACGGCCACAGGCGTCCCGGTGACGATCGCCAAGGCCGACGGTTCCCCCGTCAACGCGGCCTCCATGCTGGCCGTCCTCGGCCTCGGCGCCCAGGGGGGCGAGGAGATCGTCCTCGCCTCCGACGCCGAGGGCGCGGAGGCGGCCCTGGAGCGGCTGGCGAAGCTGGTCGCCGAGGGGCTCGAGGAGCTTCCCGAGACCGTCTGA |
| Sequence | MAERRVNVGWAEGLHARPASIFVRAATATGVPVTIAKADGSPVNAASMLAVLGLGAQGGEEIVLASDAEGAEAALERLAKLVAEGLEELPETV |
| Source of smORF | Swiss-Prot |
| Function | General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain. |
| Pubmed ID | 12000953 10491187 |
| Domain | CDD:412221 |
| Functional Category | Others |
| Uniprot ID | O50515 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 141
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5923849 | 5924130 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 2 | 5901820 | 5902101 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 3 | 2251011 | 2251292 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 4 | 5473642 | 5473923 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 5 | 6287884 | 6288165 | - | NZ_CP070242.1 | Streptomyces californicus |
| 6 | 6317438 | 6317719 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 7 | 2450116 | 2450397 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 8 | 7030609 | 7030890 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 9 | 6186396 | 6186677 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 10 | 6516667 | 6516948 | - | NZ_CP023691.1 | Streptomyces platensis |
| 11 | 1681314 | 1681595 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 12 | 1687186 | 1687467 | - | NZ_CP030862.1 | Streptomyces globosus |
| 13 | 5740215 | 5740496 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 14 | 6676694 | 6676975 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 15 | 5954614 | 5954895 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 16 | 6029972 | 6030253 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 17 | 6936679 | 6936960 | - | NZ_CP022685.1 | Streptomyces formicae |
| 18 | 2759848 | 2760129 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 19 | 2437223 | 2437504 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 20 | 6020962 | 6021243 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 21 | 7593549 | 7593830 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 22 | 1915817 | 1916098 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 23 | 2739896 | 2740177 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 24 | 2447026 | 2447307 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 25 | 5760510 | 5760791 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 26 | 6920446 | 6920727 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 27 | 2417094 | 2417375 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 28 | 7930678 | 7930956 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 29 | 5042804 | 5043085 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 30 | 6320851 | 6321132 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 31 | 2418679 | 2418960 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 32 | 6453420 | 6453701 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 33 | 5693658 | 5693939 | - | NZ_CP029043.1 | Streptomyces nigra |
| 34 | 6540974 | 6541255 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 35 | 2732700 | 2732981 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 36 | 2531869 | 2532150 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 37 | 6967132 | 6967413 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 38 | 5320881 | 5321162 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 39 | 7664610 | 7664891 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 40 | 2688544 | 2688825 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 41 | 5233261 | 5233542 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 42 | 2234025 | 2234306 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 43 | 6933140 | 6933421 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 44 | 8008825 | 8009106 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 45 | 5627043 | 5627324 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 46 | 2959910 | 2960191 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 47 | 5874084 | 5874365 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 48 | 6283351 | 6283632 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 49 | 6561136 | 6561417 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 50 | 2638432 | 2638713 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 51 | 5547185 | 5547466 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 52 | 2947307 | 2947588 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 53 | 6146531 | 6146812 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 54 | 6326722 | 6327003 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 55 | 2218535 | 2218816 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 56 | 7124447 | 7124728 | - | NZ_CP070326.1 | Streptomyces noursei |
| 57 | 7537945 | 7538226 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 58 | 6492601 | 6492882 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 59 | 6744257 | 6744538 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 60 | 1960346 | 1960627 | + | NZ_CP022310.1 | Streptomyces calvus |
| 61 | 6438100 | 6438381 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 62 | 6374205 | 6374486 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 63 | 2051524 | 2051805 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 64 | 4794310 | 4794591 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 65 | 2695725 | 2696006 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 66 | 2497756 | 2498037 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 67 | 1379550 | 1379831 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 68 | 6686215 | 6686496 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 69 | 6783581 | 6783862 | - | NZ_CP027306.1 | Streptomyces atratus |
| 70 | 9163705 | 9163977 | - | NZ_CP027306.1 | Streptomyces atratus |
| 71 | 5982103 | 5982384 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 72 | 1946121 | 1946402 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 73 | 4265005 | 4265286 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 74 | 5650827 | 5651108 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 75 | 1595417 | 1595698 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 76 | 328981 | 329259 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 77 | 1739465 | 1739746 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 78 | 1219838 | 1220119 | + | NC_020990.1 | Streptomyces albidoflavus |
| 79 | 46259 | 46537 | + | NC_020990.1 | Streptomyces albidoflavus |
| 80 | 6085607 | 6085888 | - | NZ_CP031194.1 | Streptomyces paludis |
| 81 | 7879457 | 7879738 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 82 | 5654159 | 5654440 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 83 | 1750780 | 1751061 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 84 | 4973130 | 4973411 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 85 | 1984073 | 1984354 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 86 | 8246840 | 8247112 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 87 | 4917415 | 4917696 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 88 | 2033626 | 2033907 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 89 | 4299653 | 4299925 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 90 | 5971291 | 5971572 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 91 | 6139010 | 6139291 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 92 | 213879 | 214151 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 93 | 5027114 | 5027395 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 94 | 1582430 | 1582714 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 95 | 5145051 | 5145329 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 96 | 2383585 | 2383863 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 97 | 6051976 | 6052254 | - | NC_016109.1 | Kitasatospora setae KM-6054 |
| 98 | 2797826 | 2798095 | - | NZ_CP033325.1 | Georgenia faecalis |
| 99 | 571285 | 571554 | + | NZ_LT985188.1 | Micropruina glycogenica |
| 100 | 1773547 | 1773816 | - | NZ_LT906453.1 | Dermatophilus congolensis |
| 101 | 3133245 | 3133481 | - | NZ_CP051884.1 | Cellulomonas taurus |
| 102 | 2400902 | 2401171 | - | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 103 | 2705054 | 2705314 | + | NZ_LR134442.1 | Propionibacterium australiense |
| 104 | 3469797 | 3470063 | + | NZ_CP030033.1 | Cryobacterium soli |
| 105 | 3262791 | 3263057 | - | NZ_CP016282.1 | Cryobacterium arcticum |
| 106 | 1006823 | 1007077 | - | NZ_CP038266.1 | Microbacterium wangchenii |
| 107 | 2492675 | 2492905 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 108 | 767965 | 768219 | - | NZ_CP031423.1 | Microbacterium lemovicicum |
| 109 | 305093 | 305365 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 110 | 1093814 | 1094074 | + | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 111 | 2405027 | 2405281 | + | NZ_CP044231.1 | Microbacterium caowuchunii |
| 112 | 754033 | 754308 | + | NZ_CP064760.1 | Microbacterium schleiferi |
| 113 | 2255260 | 2255529 | + | NZ_CP017146.1 | Marisediminicola antarctica |
| 114 | 975303 | 975557 | - | NZ_CP044232.1 | Microbacterium lushaniae |
| 115 | 1328846 | 1329118 | - | NZ_LR134406.1 | Arachnia propionica |
| 116 | 3597424 | 3597693 | - | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 117 | 6819776 | 6820060 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 118 | 1907863 | 1908129 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 119 | 612989 | 613255 | + | NZ_CP053642.1 | Actinomyces marmotae |
| 120 | 808190 | 808465 | - | NZ_CP038256.1 | Microbacterium sediminis |
| 121 | 1028060 | 1028368 | + | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 122 | 2702062 | 2702328 | - | NZ_CP039292.1 | Actinomyces procaprae |
| 123 | 6572145 | 6572420 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 124 | 1987206 | 1987472 | - | NZ_CP066060.1 | Actinomyces oris |
| 125 | 2895663 | 2895935 | + | NZ_CP061344.1 | Microbacterium hominis |
| 126 | 1925929 | 1926201 | + | NZ_LN849456.1 | Devriesea agamarum |
| 127 | 1248768 | 1249034 | - | NZ_LR134350.1 | Actinomyces howellii |
| 128 | 1901340 | 1901603 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 129 | 2246036 | 2246305 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 130 | 3546302 | 3546559 | + | NC_013530.1 | Xylanimonas cellulosilytica DSM 15894 |
| 131 | 7074311 | 7074580 | + | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 132 | 85733 | 86008 | - | NZ_AP017457.1 | Aurantimicrobium minutum |
| 133 | 2596769 | 2597038 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 134 | 2995285 | 2995557 | + | NZ_CP023564.1 | Brachybacterium ginsengisoli |
| 135 | 2779694 | 2779954 | - | NZ_LR134352.1 | Nocardia asteroides |
| 136 | 9410351 | 9410617 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 137 | 3003749 | 3004018 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 138 | 4715312 | 4715593 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 139 | 4600848 | 4601117 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 140 | 4317797 | 4318063 | + | NZ_CP016353.1 | Prauserella marina |
| 141 | 2724847 | 2725116 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 142 | 2160019 | 2160303 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 143 | 8700345 | 8700614 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 144 | 3057193 | 3057459 | - | NZ_CP066049.1 | Actinomyces naeslundii |
| 145 | 4096152 | 4096421 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 146 | 1539301 | 1539570 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 147 | 26045 | 26311 | + | NZ_LR134477.1 | Actinomyces viscosus |
| 148 | 8593144 | 8593413 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 149 | 2922000 | 2922266 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012382.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05193.23 | 0.62 | 88 | 2875.5 | opposite-strand | Peptidase M16 inactive domain |
| 2 | PF00675.22 | 0.62 | 88 | 2709 | opposite-strand | Insulinase (Peptidase family M16) |
| 3 | PF07729.14 | 0.61 | 86 | 205.0 | opposite-strand | FCD domain |
| 4 | PF00392.23 | 0.7 | 99 | 225.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 5 | PF13549.8 | 0.64 | 90 | 179.0 | opposite-strand | ATP-grasp domain |
| 6 | PF13607.8 | 0.62 | 88 | 179.0 | opposite-strand | Succinyl-CoA ligase like flavodoxin domain |
| 7 | PF13380.8 | 0.63 | 89 | 179 | opposite-strand | CoA binding domain |
| 8 | PF00583.27 | 0.63 | 89 | 179 | opposite-strand | Acetyltransferase (GNAT) family |
| 9 | PF02629.21 | 0.61 | 86 | 179.0 | opposite-strand | CoA binding domain |
| 10 | PF13302.9 | 0.67 | 95 | 179 | opposite-strand | Acetyltransferase (GNAT) domain |
| 11 | PF19461.1 | 0.64 | 90 | 3175.5 | opposite-strand | Family of unknown function (DUF5998) |
| 12 | PF01663.24 | 0.64 | 90 | 3771.0 | opposite-strand | Type I phosphodiesterase / nucleotide pyrophosphatase |
| 13 | PF00265.20 | 0.6 | 85 | 5024 | opposite-strand | Thymidine kinase |
++ More..