Result : O50461
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Toxin RelE (EC 3.1.-.-) (Putative endoribonuclease RelE) |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1388685 |
| Right | 1388978 |
| Strand | - |
| Nucleotide Sequence | GTGAGCGACGACCATCCCTACCACGTGGCGATCACCGCGACAGCGGCACGCGACCTGCAACGCTTACCCGAAAAGATCGCCGCCGCATGTGTCGAGTTTGTTTTCGGACCGCTGCTTAACAACCCGCATAGGTTGGGCAAGCCGCTGCGCAATGACCTTGAAGGCCTCCACTCAGCCCGCCGCGGTGATTACCGCGTCGTCTACGCCATCGACGACGGCCACCACCGAGTCGAGATCATCCACATCGCTCGTCGCAGTGCCAGCTACCGAATGAACCCGTGCCGGCCACGTTAA |
| Sequence | MSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEIIHIARRSASYRMNPCRPR |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity (By similarity). Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB (shown only for M.smegmatis). {ECO:0000250, ECO:0000269|Pubmed:19114484, ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:20061486, ECO:0000269|Pubmed:20498855}.; In combination with RelB represses its own promoter. Has been seen to bind DNA in complex with cognate antitoxin RelB but not alone. |
| Pubmed ID | 9634230 15718296 19114484 20011113 20061486 20498855 21969609 |
| Domain | CDD:419697 |
| Functional Category | DNA-binding_and_Toxin_type_2 |
| Uniprot ID | O50461 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1388685 | 1388978 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3177834 | 3178085 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1408772 | 1409065 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 3236468 | 3236719 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 3821676 | 3821960 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 6 | 7274002 | 7274262 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 7 | 2722836 | 2723096 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 8 | 4738698 | 4738988 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 9 | 3592583 | 3592873 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 10 | 2831889 | 2832179 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 11 | 251541 | 251834 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 12 | 5399231 | 5399509 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
| 13 | 4570731 | 4570976 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 14 | 6836392 | 6836673 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 15 | 4926432 | 4926695 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 16 | 971580 | 971831 | + | NZ_LT985188.1 | Micropruina glycogenica |
| 17 | 2626973 | 2627218 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 18 | 2630091 | 2630372 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 19 | 3815742 | 3816029 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 20 | 2176611 | 2176886 | - | NZ_CP060789.1 | Tessaracoccus defluvii |
| 21 | 3201789 | 3202061 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 22 | 2014072 | 2014347 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 23 | 2695473 | 2695748 | - | NZ_CP061344.1 | Microbacterium hominis |
| 24 | 3226640 | 3226915 | + | NZ_CP018762.1 | Microbacterium aurum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02604.21 | 0.95 | 19 | -3 | same-strand | Antitoxin Phd YefM, type II toxin-antitoxin system |
++ More..