Result : O50456
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB33 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1384278 |
| Right | 1384538 |
| Strand | + |
| Nucleotide Sequence | ATGCGCACCACCTTGACGCTCGATGACGACGTCGTCCGGCTGGTCGAAGACGCAGTGCATCGCGAACGCCGCCCGATGAAGCAGGTCATCAACGATGCGCTGCGCAGAGCGCTGGCGCCGCCGGTGAAACGGCAGGAGCAGTATCGGTTGGAGCCGCATGAGTCGGCTGTGCGTTCCGGGTTGGATCTGGCCGGCTTCAACAAGTTGGCCGACGAACTGGAGGATGAGGCGCTGCTGGATGCCACGCGTCGGGCCCGGTGA |
| Sequence | MRTTLTLDDDVVRLVEDAVHRERRPMKQVINDALRRALAPPVKRQEQYRLEPHESAVRSGLDLAGFNKLADELEDEALLDATRRAR |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC33. {ECO:0000269|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O50456 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1384278 | 1384538 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1404370 | 1404630 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 904669 | 904935 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 3953314 | 3953574 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 5 | 1313894 | 1314145 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.6 | 3 | 4428 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF00005.29 | 0.6 | 3 | 2413 | same-strand | ABC transporter |
| 3 | PF17912.3 | 0.6 | 3 | 2413 | same-strand | MalK OB fold domain |
| 4 | PF01544.20 | 0.6 | 3 | 1236 | opposite-strand | CorA-like Mg2+ transporter protein |
| 5 | PF02866.20 | 0.6 | 3 | 76 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
| 6 | PF00056.25 | 0.6 | 3 | 76 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 7 | PF01850.23 | 0.8 | 4 | -3 | same-strand | PIN domain |
| 8 | PF00934.22 | 0.6 | 3 | 451 | opposite-strand | PE family |
| 9 | PF00106.27 | 0.6 | 3 | 3260 | opposite-strand | short chain dehydrogenase |
| 10 | PF13561.8 | 0.6 | 3 | 3260 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 11 | PF08659.12 | 0.6 | 3 | 3260 | opposite-strand | KR domain |
++ More..