Result : O50319
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Heat-stable enterotoxin C (Y-STC) |
| NCBI Accession ID | D63578.1 |
| Organism | Yersinia enterocolitica |
| Left | 88 |
| Right | 306 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAATCGTTTTTGTTCTGACGTTAATGCTGTTTTCATTCGGAACGTTAGGTCAGGAGACGGCTTCAGGGCAGGTTGGTGATGTATCATCGTCAACAATAGCTACTGAGGTAAGTGAGGCTGAGTGCGGTACTCAGTCAGCAACAACCCAAGGCGAAAATGATTGGGATTGGTGCTGTGAGTTATGTTGCAATCCTGCTTGTTTTGGTTGCTAA |
| Sequence | MKKIVFVLTLMLFSFGTLGQETASGQVGDVSSSTIATEVSEAECGTQSATTQGENDWDWCCELCCNPACFGC |
| Source of smORF | Swiss-Prot |
| Function | Toxin which activates the particulate form of guanylate cyclase and increases cyclic GMP levels within the host intestinal epithelial cells. Highly toxic. |
| Pubmed ID | 9049998 7729521 |
| Domain | CDD:307942 |
| Functional Category | Others |
| Uniprot ID | O50319 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2015735 | 2015950 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 2 | 1493052 | 1493267 | + | NZ_CP032487.1 | Yersinia hibernica |
| 3 | 2037288 | 2037503 | + | NZ_CP043727.1 | Yersinia canariae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043727.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06173.14 | 0.67 | 2 | 5790.5 | opposite-strand | Protein of unknown function (DUF986) |
| 2 | PF03613.16 | 1.0 | 3 | 4811 | opposite-strand | PTS system mannose/fructose/sorbose family IID component |
| 3 | PF03609.16 | 1.0 | 3 | 3998 | opposite-strand | PTS system sorbose-specific iic component |
| 4 | PF03830.17 | 1.0 | 3 | 2931 | opposite-strand | PTS system sorbose subfamily IIB component |
| 5 | PF03610.18 | 1.0 | 3 | 2931 | opposite-strand | PTS system fructose IIA component |
| 6 | PF03741.18 | 1.0 | 3 | 617 | same-strand | Integral membrane protein TerC family |
| 7 | PF03471.19 | 1.0 | 3 | 617 | same-strand | Transporter associated domain |
| 8 | PF00571.30 | 1.0 | 3 | 617 | same-strand | CBS domain |
| 9 | PF03313.17 | 1.0 | 3 | 83 | opposite-strand | Serine dehydratase alpha chain |
| 10 | PF03315.17 | 1.0 | 3 | 83 | opposite-strand | Serine dehydratase beta chain |
| 11 | PF00425.20 | 1.0 | 3 | 2505 | opposite-strand | chorismate binding enzyme |
| 12 | PF04715.15 | 1.0 | 3 | 2505 | opposite-strand | Anthranilate synthase component I, N terminal region |
| 13 | PF03701.16 | 1.0 | 3 | 4071 | same-strand | Uncharacterised protein family (UPF0181) |
| 14 | PF02222.24 | 0.67 | 2 | 4407.0 | opposite-strand | ATP-grasp domain |
| 15 | PF02655.16 | 0.67 | 2 | 4407.0 | opposite-strand | ATP-grasp domain |
++ More..