Protein Information |
Information Type | Description |
---|---|
Protein name | Heat-stable enterotoxin C (Y-STC) |
NCBI Accession ID | D63578.1 |
Organism | Yersinia enterocolitica |
Left | 88 |
Right | 306 |
Strand | + |
Nucleotide Sequence | ATGAAAAAAATCGTTTTTGTTCTGACGTTAATGCTGTTTTCATTCGGAACGTTAGGTCAGGAGACGGCTTCAGGGCAGGTTGGTGATGTATCATCGTCAACAATAGCTACTGAGGTAAGTGAGGCTGAGTGCGGTACTCAGTCAGCAACAACCCAAGGCGAAAATGATTGGGATTGGTGCTGTGAGTTATGTTGCAATCCTGCTTGTTTTGGTTGCTAA |
Sequence | MKKIVFVLTLMLFSFGTLGQETASGQVGDVSSSTIATEVSEAECGTQSATTQGENDWDWCCELCCNPACFGC |
Source of smORF | Swiss-Prot |
Function | Toxin which activates the particulate form of guanylate cyclase and increases cyclic GMP levels within the host intestinal epithelial cells. Highly toxic. |
Pubmed ID | 9049998 7729521 |
Domain | CDD:307942 |
Functional Category | Others |
Uniprot ID | O50319 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2015735 | 2015950 | + | NZ_CP011118.1 | Yersinia enterocolitica |
2 | 1493052 | 1493267 | + | NZ_CP032487.1 | Yersinia hibernica |
3 | 2037288 | 2037503 | + | NZ_CP043727.1 | Yersinia canariae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06173.14 | 0.67 | 2 | 5790.5 | opposite-strand | Protein of unknown function (DUF986) |
2 | PF03613.16 | 1.0 | 3 | 4811 | opposite-strand | PTS system mannose/fructose/sorbose family IID component |
3 | PF03609.16 | 1.0 | 3 | 3998 | opposite-strand | PTS system sorbose-specific iic component |
4 | PF03830.17 | 1.0 | 3 | 2931 | opposite-strand | PTS system sorbose subfamily IIB component |
5 | PF03610.18 | 1.0 | 3 | 2931 | opposite-strand | PTS system fructose IIA component |
6 | PF03741.18 | 1.0 | 3 | 617 | same-strand | Integral membrane protein TerC family |
7 | PF03471.19 | 1.0 | 3 | 617 | same-strand | Transporter associated domain |
8 | PF00571.30 | 1.0 | 3 | 617 | same-strand | CBS domain |
9 | PF03313.17 | 1.0 | 3 | 83 | opposite-strand | Serine dehydratase alpha chain |
10 | PF03315.17 | 1.0 | 3 | 83 | opposite-strand | Serine dehydratase beta chain |
11 | PF00425.20 | 1.0 | 3 | 2505 | opposite-strand | chorismate binding enzyme |
12 | PF04715.15 | 1.0 | 3 | 2505 | opposite-strand | Anthranilate synthase component I, N terminal region |
13 | PF03701.16 | 1.0 | 3 | 4071 | same-strand | Uncharacterised protein family (UPF0181) |
14 | PF02222.24 | 0.67 | 2 | 4407.0 | opposite-strand | ATP-grasp domain |
15 | PF02655.16 | 0.67 | 2 | 4407.0 | opposite-strand | ATP-grasp domain |